SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02955T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02955T0
Domain Number 1 Region: 154-307,334-554
Classification Level Classification E-value
Superfamily RNI-like 6.54e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.032
Further Details:      
 
Weak hits

Sequence:  AMSG_02955T0
Domain Number - Region: 89-116
Classification Level Classification E-value
Superfamily F-box domain 0.000278
Family F-box domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_02955T0
Sequence length 619
Comment | AMSG_02955 | Thecamonas trahens ATCC 50062 F-box/LRR-repeat protein 20 (620 aa)
Sequence
MECVASDQMVGEGENVWSWLPDELKLKVLMEMMPDGRRGGGADERSKRRLAWFARVREDQ
TRSDFRRKHALPAVAAEGIMGRTAVFSQAELLRLAGVCRDMRRIVWDGTLWRALHLAPVV
RSMGTAPVLAELLPRIGGGLRELSLARCASLGLAASAVAACPRLQSLDLTGVFVSSASPA
GGGGGGVDLAGLLAPLGGLEVLVLDECMLGESDLQAIESCVPKLRVLSLRDVRGVIQSPS
AVSPLARAPQALEVLALDGCWRMSEALLLDVVRKHADSLRSLSVARCSDAVSNAALVAIG
EAVGRELEEVIIDGCVKASSAGVVALVEACEGRALKTLSLGHCDFVRDEVVEAIARATPN
LTYLSLEGCHRLNDEAVCAALRRLDSASGLVSLNLARCRKLTDNVLHTLADIGVMHLQSL
DISECGYMRSRTLIELAGVTPAMRRVRLRRVNKVFTSSFMELIPLWPKLELIDLSGDSSL
RNEAVLTMIAACPELQIVDLSALRITDEVLEAIASGLPKLVSLTLRRCRMITDAGVAALA
GGCPALAYVDLFRATEVSEAGFEALASRGVYVNEWAVPKAAEEQGNNALGNEAFWGAREM
MSAHGDAHFLRAIARLEGR
Download sequence
Identical sequences A0A0L0D2G6
AMSG_02955T0 XP_013760300.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]