SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_02974T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_02974T0
Domain Number 1 Region: 75-383
Classification Level Classification E-value
Superfamily RNI-like 3.38e-46
Family Rna1p (RanGAP1), N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_02974T0
Sequence length 1455
Comment | AMSG_02974 | Thecamonas trahens ATCC 50062 NOD3 protein (1456 aa)
Sequence
MFEHTVSLGSAEQSLPQSIKYLFLSDAVTTVDVSGLGVTDADLAFLATYLSTDAIEIDSD
PEPVLPIAPQDAISIVMELDVSASAFSVAGLTLLVEGLYTNSVLRTLLLDGNEIDNRGAR
ALGALLASPHSDLRRLSLVDNAIGDKGARHLVRALAHPARDTGAMGKAPSLVQLDMAYNT
TSPAPWAELLQSRTCEVEVLNLAYNSRFTAKASVPLFHALAQFNTSLVALVLEGNTLGSE
GGTALARALALNGTLTELNVNKTGLTDGALAEIGSALARNPSLVILQAAGNELGSGPAAD
KAAPGTVGLRALGRAVAHNTTLRVLNIANNAIKAGCGASALFAPLAANASLEVLDARGNE
LGLEGLSALVAGVQGNLSLTEVNGLAPDAFVASAGRALNATHLGSSSSSALSSVPGSSES
VSTPTASLSGGSRRKSDAGSYRVSLDALGSSLGGSGEDDSGEGTTETQELRSHGVRYVVD
MEYVYPPLDIACNAFTLWDDGVVSLSDPTATLLDLAAGLGDVELATALLATHYVSGASVE
DFVLKRALLFGVQRPAVPLEMLALLLRGCLARGVAVRYDVAAMAALRAGNRAALKLLNGV
AGASPLYWLTPLPRSLAVAPSRPLRDYFAAAGEALSSVLVAHGVNARRRRLTLPAPDVLD
AMVRALPPHEGGVPQGVFWLSRTLHSDPYLRNGLELLASALTVSTRPILLALLHAARPGS
RLPVFREQLSAAYQFVDSISEFGHGFYGSLLHEIGTAGNALAAEVLLNSLLGAEAPESMQ
GGLYAEDARGLTPLECVVRGRGDALRFAHGTPWAEHIRREYASVEVAFRGSMDREEEREY
SRERNRIWAVRYAGLWAGAVAAAVASVVVLPAAVLGSVVRRGEPLALVSDMADERLGGTR
LSFIPGEAHLVPGGATSSDVSAVLGSESEEQEARETSGSVSTFDILHYSTSSLLSRVGSW
QSDGSTTDGELVLQGYSEGSVQAPRDLLVANSRGDRLSNAVRTEFARSSGSCTSCSSISW
HASPTWLHAWLLVVGVGLAVLVSARGWGETEGVRMAAVLGGWACAGVLVVTQYAAFVAWS
PRAFVVPLPKDVAWRSSFANAVALSARTAELVQLAGLALLVHPPSWGAGAGLHQVLESIS
GGSARPRGTGLVLLLTGLGVWWLLGVGFVLFSVAVLGARGARSPLSWRAFSWRRSWLWLG
PRLVGVVPLLASFVAPAAVQGGLVPLLRLCALGADWEVDGRVSATVLLAAGVLLALSASS
VGLYLRMAAPPTLTERLVPHVIVVEVVGKLAGVLALTYAPAGTAWAPGVMLAVAGCGVVA
HSVSQAAVQLTARMRWLSVVGYGCVCWAALVSLLGAAGAVDVSTQLFGLVLVGGWAACGL
GLVVLVCGRIVRGLWRRRRARRHDRASRGMTRKPRGPGESSYSDRYDRTSSGWYSVNDRA
SSSSSRECSSASYTA
Download sequence
Identical sequences A0A0L0D5E3
XP_013760319.1.50528 AMSG_02974T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]