SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03143T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03143T0
Domain Number 1 Region: 322-529
Classification Level Classification E-value
Superfamily RNI-like 1.1e-26
Family 28-residue LRR 0.0073
Further Details:      
 
Domain Number 2 Region: 568-726
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000314
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 671-823
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000942
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_03143T0
Sequence length 1950
Comment | AMSG_03143 | Thecamonas trahens ATCC 50062 hypothetical protein (1951 aa)
Sequence
MGCGASSPSPDDPPLRRTKAGGREQESAGAGSEPRHSTPARKSSKAGKSRSKSPKEPARS
PATLSTKTRGQSPEQKPSSHTDPLPLWIRWANGLEPVAPPGTPADQVAAAARVSSDGWLV
LRGCTDLADGDVGAMLDRIGADVVALDLRATLVSAQVLYEVASNCPLVQVVLLDDDALAA
PDADPLMDGSLVAPDSPSDSIGSGGALKWLHSMVEGHPVLPRLLTLYGVYDEYYDAADYG
LDNLALLLEEDALDPRASLALPPRALVAPHRIADALVAVTSNAAAVTLRPGNVDNDDDDD
LATPALWLPTLSAFLARPPVQAALTRLVLFDTQLSADDAARIGTALTSGVIMPSLTHLSF
EMNELGDSGVSAIVDALASPQAPAALPNLVSLNLNCVACGVDGAAALGALICGSHTLTAI
TAYANEDIGNRGAAALAAALSLPETRSILALLDLGACDIGSPGIDALASSALFARDGSIP
LRALRLNGNAVDDAAVAHLLPALARAHSLTSLDLMSNALTQAGANELLTAAAAEPRLAHG
GILLDAALTQLLPSLCTPGFAAPNLGSLACVPCLPGTYAPAGNASVCDPCPRGSASAAPE
ATFCTPCSAGTFAPNDGALVCSPCLPGSFSTTDGAPGCTLCPIGTAQPASGARACESCKP
GFFEGSEGAPSCSRCPIGTYQPSSGASGCIACPPATSSSPDFTSCEPCPVGTFNPVDGGE
CQPCPADAFTNVTGSLSCKACAAGGAGSQPIADRCVSAPGFRTDPATGAYVACQVAAACC
LGELCGPCGAATSKPAYVGSLCESCAPGFYSPSNNGVCSQCPNYSGFVIAGLVVAVLVVC
LVLVRTAKSGKLYFTSISIAFNFFQVTAVLITFDLGWPSSVRSLFERLSVFYFNLDVVSL
DCTSSGGMSYETKWLLKLLFPLAFVAMFLLIYICILIHGLLLACRARIQRKRAAKARGDA
GTSLLAHDVIQVSSASTPSTVLALINNAKYRRACINACLSLFSIVYIMLLVTMLEVFDCA
RPDGAGAGSARTMRAAPLIPCTTASAQWTWLRNASVIGLAFYGIGIPAAFAAVLLVQRER
LHHPSAIAICGLLYRRYRSEHYLWELVILARKIGVVGGKLLAGQVDLQIILIAAVMVTAL
GFQLGSQPYIERATNRLELISLSASSLILSLGVVLYRVNARKGESALLEAMQFWTALLVI
GLVGVFSAIILVAVAVEIVHIRNMQLAGIVGGYATDNVHVFSHFFTSHFRIVSQLQYSTT
SDGRLSLVLQYGNEEAATVDARIRSETRATSHGPTAVSLTTTQLANSGEARDERALDMSL
VVQHNPEYHTVHLDVLFYKSGRYVMVVSGGAPIVPSTGWCWGRCGRDANQDGNDVWHPRR
ALLDYRSTVTADADADVAAHPRQDIIDVDALTGHGAVVVTPITAILDTGSLVTFRAVVLG
AAYVAVHYLDRNVLTLLARESLSDGPGETIPADGLHAPSLNEDVAPGYSDVFSGDVEIAA
SGEYVLVAFLPYLSDEAREGVARPAPILANTPSIVRASSSVDWSAKPRARDMTDLRKQIL
WNIEPPLGGSSARVSKSPRGGLGARDSDRASGSDSWSDASGATGHAVRLSNVADMDGHRG
ASQSSALGDSYDEYDAGEYGGYGDGYGYGYGYEYSEQHESLFGESNGHVVGKGKTKAKGK
GKGKAKAKTKAKAKAKAKAKAKGKSKARVLDEDKDVADVAVELERLRRVVLVQYAAELRA
DVVPIFGDDDDREAPHVAVLPTTPHVGGGDDGPGRGRSAWDKPGSARDESAGSPKTRTRS
ASRGVADDGGDGGSGGGRAPESRMSSQSRSVRELSRSRGSTPQSREVSASPARSISQSSR
PARRGQPRRSASLQPQAADNLVSVALAASGPGRVRRSDTRTRSRSRSRVVVDDDFDSSSS
TSGHGFSCRLEQQHSRSMPRVDRLHMLDDL
Download sequence
Identical sequences A0A0L0D3G5
AMSG_03143T0 XP_013760472.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]