SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03310T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03310T0
Domain Number 1 Region: 258-365
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-16
Family Second domain of FERM 0.0011
Further Details:      
 
Domain Number 2 Region: 2405-2564
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000334
Family I/LWEQ domain 0.01
Further Details:      
 
Weak hits

Sequence:  AMSG_03310T0
Domain Number - Region: 872-954
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0196
Family I/LWEQ domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_03310T0
Sequence length 2616
Comment | AMSG_03310 | Thecamonas trahens ATCC 50062 hypothetical protein (2617 aa)
Sequence
MLAPVRAPQSRIAGSGNVRTVGYNGELAQKQFELEGHVTFTDMDLRVELYKRNPLGVEEL
VLGRVVRGVNPAMTVRELCHRVNDELNHGSADSTPEQGWGLFIPWDAQASLINTGAAPSS
SLVDVEFKSQYLELHHDLHRYNLTGGMRLHYKQRRRTIRVLVFDAVKRVLIDEAWNVQKI
SEAVATAAGVRNVAEYSLKLRDDPEEPEAGWLNVNLTLHEQKVRLDPWEANNETHVPDPL
IFKQKLFFPDGARGHVDEDLADPLQARLLYRQYRQMVSTRQMPVSEDEAVALAACILQIE
EGDYTKSKEAHAALDGALATIVPPPHTEAKKIDDAVVKAYKALRGMSGVAAVRKYVELVR
GSPTFGWAFFEMRERIVAGRRARNIPRLLAVGGKGIARVEPKAMRFLISNPWADLTEAYG
AQVDSLPGLRIEFASEPLAPFQCVLGKQDEQYVHDLLRLIREYFAYFAAHVVVDTGEEMA
PPVWDEVRRPTAASLIYPARPKGKQREPERKLVNMVISASDAPPASPAQVKSAMPGIVAA
ASAALPSTADAPLPQRAAAVDADFEDDDAREARLLAVADSNDALVDVTAAVNIGLANLVL
AAGGGEPSLVDSSLLLAAAQSVADALGEMRGTVDKGAELASDPIDAAALGNAYNTVSSGA
LTMLGAAGAVLGPSGTIDTLALDSLLGAASNVSGALAAMLGAAGVGAPASRAGDSLLELT
ARMANVEAPAFAVSMDGKHFSELPVVTTHKLHAQAASLPKATARFYAQLQLLLPSIKVDA
AAASLLAQARMMATMVESATVAVPIDENEPYAAGSTLRTTMQAVLAGLEALVTVPIVDDA
VAEAASAIDASLSKILEHADEPATVRALVNGVGMRVASLCELASLEAGAFGMGGSYDSLL
AASQDVADALAKLKGASRALSATDGSDEARESLECAVAGVQDARGAFVAERTQLEVMREV
VALVENVQDKLAVTVARLTPVSASMEEGRAKEKSSRALADAQRTTDSLHRAMRVYAAAPA
ELASQDKFLQAARKAVDKSHRLATAAKTSEDEGAEAAGGALAESVDALEAGTQKASVVCW
PIDLNYALELIRGALRRLAAESAAAAEGKLVRGSDVDDRDASALQRQDALVASVSAVPPV
GEALVESALTKTAPEMSQVAKDVAAEIVHASDSASALAQVVEAAEDQHTLLEAAVAVCHE
GAALISKAREARRRPNDATQEFILMHGNELLREALHKLELAMPGAGDCASGVEAMAAALE
KINAEAVPSGLDDLLAVTQMLAGAMEVLSSGSSGAVPDAMLSGVPDSSDLVAHGDPTHGF
KNDVVSAGRALCSAMGKLETAAASSPRDLALVARRVTSIGQLLTEVVTGAAASDEFKAAK
ADLLVPLEAVIEAVSSGLAAAGELAKSTEPNPRASGVLQSSEVPAAVKTLNKAIDSVVNP
SKSTQAKEFKAAVSAILKALPGLEPAHLPPASQYPIHGLQEDLLHAADLLSLSLHKLSDV
AATRPNSASKQAKATATLAARLVGKAAVAGATVQASGRSVQTNEAGRAGSKVETSESRKA
SNTTAYDELQDELKAVMKALASLLRAKPSSKKKFKGAYTKVVLAVRDLLVAAKEVYKSLA
DAEADKDALKSLGSKIKSAATKLAKAADANASAPDDSSVHKKFLSAAKSFASALKTYESA
TKSAALGAGLLGGGSLAGPSGAPGGDGGSLVDELLGGAAAVGNAVNTLIAASKLVSSDVT
SAKAQSKMDKKLKSALEALGVLQQHARLITPGQKECADGAEAAVRVAQELGKAALEVGVS
RPKAGAGRQYGTKAAALSGALSGVEAGLQALGEAAVSSADALVRAAAELAAALGNLPGKL
RGAAEAAAQPALGARILRSGAGVAEAAMVLFESASEAGGDPKHAGRIRPVVAHALEAVRA
VTAVVKAEEAAGEAGRAAEAQVEAALARLREGAAAPEAAAASLVDGLKYGDYQKAVKTRL
LELVRGASEVMDAAQTAPETVTSAVLVVTEALPGVVAAVLGCMALTGEDEARQALLAAGE
AMAAAIAQLATGASSVLMGSPTGLSAVSSGSQQLSEALTQVLGAAARGATGKRMLEGAVS
AMSQTLGELETIKFLVGAQELPNEANAEFGELVGSLRSAASELVELVESSVGAEGSIELS
AEERGAFAMEAAEAAAKVVELAELGAAALDEAVDQMALLNAAGNLACALKSLVVESGGLS
GLQSAAAAFGGAVDAAAAADKRVQATIDQVCDKVMASAAAAEALQKSGKGGTGTGSSPSR
AEVSAVESAAKGVLLFSQRLLFAAGRGKHAFLELAEEVPAALETLVKALSRALGGGERMG
VPGADAVAEGGANLGPCLVEQLQAFGLSGDVMSEAAKGVSTGVTTVLTGLGRLKSVEAGL
DPLVAFEHEMAQVTADINAMKSSLAELAQLAASVAGAKADAAHDAFVALVIKASQEIVSA
GVVLVEVAIAAHKGAQAADHEDMVLAARAVAAATGELVAAARFFIQGEARVEALERAASS
VADAIHELVEVVSGGAETEAFKRLRGAAAGVESSCKSLAAAATSFAKPAVRPTAASGAGG
PGAVGSGATADSIKEMIRRRAEMEKLQRNLAKLKAP
Download sequence
Identical sequences A0A0L0D3K3
XP_013760152.1.50528 AMSG_03310T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]