SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03437T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03437T0
Domain Number 1 Region: 630-858
Classification Level Classification E-value
Superfamily RNI-like 6.06e-42
Family 28-residue LRR 0.036
Further Details:      
 
Weak hits

Sequence:  AMSG_03437T0
Domain Number - Region: 271-343
Classification Level Classification E-value
Superfamily Double Clp-N motif 0.0608
Family Double Clp-N motif 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_03437T0
Sequence length 876
Comment | AMSG_03437 | Thecamonas trahens ATCC 50062 NOD3 protein (876 aa)
Sequence
MSSGGAAPDKGKGEAGASSAGDKSVLEQGVALAKANPAAAAATGAVASGFLVAAGRAAFR
RLKRYSARKRNQIDRIEQAYRLYINEDFNAVKQFKFKRQYVPSYAVSRVSFSSDAYRARL
SRKLPVFDSLLRTICSYQAARARRKTRKGKLSDPTHLFLDELKDWIVAFSSSPMDTEASL
QEAEARRDYVEHVIFSGFFYPSKHFNWTTETFEQTVLQVLAILNDTLIPLIRNGIADLSV
SYQLSELSDKVNMLINESAKYCMRVFADTDDLSRTLDVLYRDVDNLNSQYKTAITLTVRE
LLTSPDARVALERADDVRSLTEDEYMRQGHPLPANFFVDHRGASIVPPGVFLRYKAAVPS
VDTSPRYFFDQIEQASGVASGVLPLFLRDPLVMETFVSLLGRLQHLAACKDLFAQAVQVA
NTGGNLSICGHREVNTHLGYLLRIVSALVAEIRSAVGRINLAADEAICNIVSAPYEEGRK
ADLVKSIAKSRRNSYKEHYKAVLTSRQQIETLVKEALATVSPILQELDKASVGDLVAEAS
EAVDKFTSHVSRLLGDAKDTSAASASRASASNTVAITKNDDVATAAAAAAAAPAAPSAPA
VVAATSSSAPGLIPSDDLASAPVDTDTLVRHIELRHLKLDDELSRQMCELQLIPHRASVV
DVDVSKCTISPGATANLCDVFANCPNLHRLRFWNAHLGDEGAAAVAGLLFREARMAPRLA
SLRSVDLNENNLGPDAAFAIADALKAGARIKWLDLGYNHIGDSGAAALAQALHHQHHLQG
LVLQNNDIADAGAAVLANMLMSNVALRHLGLQANAISDLGALTLADALDLNRTVTQLFLN
ENLIGDEGATRLLGVMRDRERVLVSVCNNRRVKAGL
Download sequence
Identical sequences A0A0L0D6S9
XP_013759793.1.50528 AMSG_03437T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]