SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03441T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03441T0
Domain Number 1 Region: 20-120
Classification Level Classification E-value
Superfamily Cap-Gly domain 6.68e-25
Family Cap-Gly domain 0.00095
Further Details:      
 
Domain Number 2 Region: 178-377
Classification Level Classification E-value
Superfamily RNI-like 1.18e-20
Family 28-residue LRR 0.031
Further Details:      
 
Domain Number 3 Region: 475-549
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000418
Family Ubiquitin-related 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_03441T0
Sequence length 566
Comment | AMSG_03441 | Thecamonas trahens ATCC 50062 tubulin-specific chaperone E (567 aa)
Sequence
MAATKTEAKSPDEVMPMGAECVGRRVQSRKNDWRGTIRFFGKVPPTPHDWYGIEWDDPSR
GKHSGCHEGVKYFDVAQDGAGSFVKASKLASKFVFGRSFADAFAERYEQALDHAPVERTI
DEAVKPGDDMSILSTTRAVAVEFVGAAKISTRLSKLEALDKVGLVREQVASAGVLGHLAG
RLDAVRTLDLACNLLTSFDDVAAIAAILPALVELGVADNRFDESRAHAGDAIPLPGLEIL
VVNRCRLGLAAVAQLAARHQMASLRELHMVESGLTTLDADLGGLGASLRLLDLSYNPLTW
AGLAPALRALPHLSTLVLAHTDLDSLDPALGVLPPMLTSLSLAWSKVASPDVLIVLAGLG
TLTHLRLHSTPLDALPLGDAALSVRVLVLALMPGLEVFNGGSRISNKERSQAERTFVKYA
DSLVACELRSAFLARAGELAAKHPDVIEEAAKAATLPPASMLPTAGSGRAGLTLVYGEAT
KSKRLKLSTQIAKLRTLIGRLFTVAVVDLEGLHLVYSHPSAPGVHYALDDSLVDLGFYNV
EDGGVIELCEDAPIEQAYSIHSGALA
Download sequence
Identical sequences A0A0L0D6T5
AMSG_03441T0 XP_013759797.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]