SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03441T1 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03441T1
Domain Number 1 Region: 49-248
Classification Level Classification E-value
Superfamily RNI-like 6.51e-21
Family 28-residue LRR 0.031
Further Details:      
 
Domain Number 2 Region: 345-420
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000279
Family Ubiquitin-related 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_03441T1
Sequence length 437
Comment | AMSG_03441 | Thecamonas trahens ATCC 50062 tubulin-specific chaperone E (438 aa)
Sequence
MSILSTTRAVAVEFVGAAKISTRLSKLEALDKVGLVREQVASAGVLGHLAGRLDAVRTLD
LACNLLTSFDDVAAIAAILPALVELGVADNRFDESRAHAGDAIPLPGLEILVVNRCRLGL
AAVAQLAARHQMASLRELHMVESGLTTLDADLGGLGASLRLLDLSYNPLTWAGLAPALRA
LPHLSTLVLAHTDLDSLDPALGVLPPMLTSLSLAWSKVASPDVLIVLAGLGTLTHLRLHS
TPLDALPLGDAALSVRVLVLALMPGLEVFNGGSRISNKERSQAERTFVKYADSLVACELR
SAFLARAGELAAKHPDVIEEAAKAATLPPASMLPTAGSGRAGLTLVYGEATKSKRLKLST
QIAKLRTLIGRLFTVAVVDLEGLHLVYSHPSAPGVHYALDDSLVDLGFYNVEDGGVIELC
EDAPIEQAYSIHSGALA
Download sequence
Identical sequences A0A0L0D3U0
AMSG_03441T1 XP_013759798.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]