SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03492T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03492T0
Domain Number 1 Region: 312-630
Classification Level Classification E-value
Superfamily RNI-like 5.57e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.074
Further Details:      
 
Domain Number 2 Region: 74-364
Classification Level Classification E-value
Superfamily L domain-like 1.02e-29
Family Polygalacturonase inhibiting protein PGIP 0.0073
Further Details:      
 
Weak hits

Sequence:  AMSG_03492T0
Domain Number - Region: 700-724,773-820
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0785
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_03492T0
Sequence length 1310
Comment | AMSG_03492 | Thecamonas trahens ATCC 50062 leucine Rich Repeat family protein (1311 aa)
Sequence
MPPHLGAGTLLCLFALAVAAAAVSVPAAELAALNALYEATNGPTWADSRGWNDGDACAAV
GVTCSTNVTAGTAHVVAIELSGNKLSGTLPASGWDLPELRILDLSDNLIGGTVPVSWGES
LQALEELNLGGERLLSLAAHEGLGPNYRYFTSIKVYSSNPLTGTLPPEWGKLSKLVMLSL
ATGGTAQGAGFVGSIPDEWIGMRSLVYINIAHSGLGGDVLAPVLARINGLRYVNARFCGF
KSIPREFVGSTISQLELTGNPMSGFEFPTWLSEWSALEEFALNICNITGTLPASLGEMTQ
LTRVVIGSAPHLHGVISPTWGNLVNMRGLFIYQIGLTGTIPPELGAWTKIERLVLAETGL
TGTIPPELGQMSAASYVLLNRNKLSGTLPRELEHMTALADLAVHSNNLSGTIPPSWGTNM
VNLVNLRAFDNSLSGTLPPGFPALEIVDVHNNNLQGHLDILCNKAKLGIVDVSSNGLSSF
PDCKTCIGEVDISNNAFVGQLPTMEHVSCLTKLSASHNMFSSSSLPSSWSRLNTTLAHLD
LSYNNLAGAVSNYLIRIKYGNSLGYIDLSHNKLSGQIQQTVFSHVDASFLQGLVRLYVND
NNIVGSVPGLLERLPLLHEVDLSNNNFTGSASPMTEDAIANADLRGNPGLREPDGISLPV
NVIAHYPLVQPSVELNYRCPTLTDTVTQRVRLDLDAHYYGASLCECLPGYHGSNGDCLSC
THLGPAVTCEGGQVVLNQRGLGLYDVYAANVTINPNYFRVGTAPSGDPLIDPCYRLSSDE
TSCNPAGAHPAVCAVGYEDRLCSRCSAGYFPQGRRCRKCPRILPELMAVAYSVSFCVWYA
INQTGRRSAVLTPLVKSLFIFMQTSALIFARSSAFFWPSSILSFFSISFGWTAVSTNVLT
CLVSSTAAWETSFVFSTLIVPGLGLFCLLAYGLLASISRCTRSGLLGKDEQHWRYGGIRS
MLAILNLMYMPITVGMLIVLPCESSADGRKYLWAAPWIECSSSNTTWVNLVVVGSVFSAL
YGLGVPVMFLAMMRARSKTLERLAAAGLVEVDGHWLQWFYAGYRPGAAWYEFVIMGRRLA
IAVVAVIPSSSPIVPLGFFMTLVVALFMHIYRQPFLYQPLNRLELLTLVQLFLTFVIGQI
FSSRTHESSLPSSSIYLEATVVVSNAGVVILYLIAIVVAVKRRVRARKSHGKARRADELP
LCEAPALSAPIKIPPLPLQTILKPAPLVLPPLRVPGPTPSLETIIDVDSYSSSGWYTATG
SEEEEQAECYEPEPPALEAEIRAFVRAHSAGDETDEALVASLLAVWNAPK
Download sequence
Identical sequences A0A0L0D714
XP_013759848.1.50528 AMSG_03492T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]