SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03538T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03538T0
Domain Number 1 Region: 469-651
Classification Level Classification E-value
Superfamily Sec7 domain 9.29e-71
Family Sec7 domain 0.00000285
Further Details:      
 
Domain Number 2 Region: 652-768
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-22
Family Pleckstrin-homology domain (PH domain) 0.00086
Further Details:      
 
Domain Number 3 Region: 89-200,231-303
Classification Level Classification E-value
Superfamily RNI-like 3.73e-17
Family 28-residue LRR 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_03538T0
Sequence length 959
Comment | AMSG_03538 | Thecamonas trahens ATCC 50062 cytohesin-1 (960 aa)
Sequence
MGGLASKRRRRAAGPVPLDDAGVLTVTSPLAFVEHMAAIKSHNARELAAIPWKPYPSLMR
VRKVDAGAAGANLSDDGMAAMTAAFPRDARILSLRGCSQLSDTALLSLVRMLVDRDGYAL
RELDLVDCPALTPRAAGFLGRIPGLVRLAIGGGAVRPAIVQVLGGWADLRELDVTACPPS
VMSDVALSALSRLHLTSLRTGVLEQVSAPALEAWCQTQPLLRVFCSPQSRCVTDSAIAAL
VEGSPLLNEIDVSGCPALSEAGLLTLSGFPRLMIVRACSTPMSDAIVLALCRGCRVLETV
ELDQDTARNALSRQGRAALENLCIPSRRCNAIIDLAVAVTGMADPRISTARRLRAQAAQR
AGPSPPPPLPALLPAYGDPQPHPERDDRQAHIACVATSTYADLDAGIGHELATLGKTFEV
DIMEAERTFEDYLAEARAAAEARAAMSAFKGMSKAQRAEAEAAELARKRLAIGVKKFNKK
PKHGMQYWEEAGLLPHKPEAVAAHLRNTEGLYKTMIGEYLGSPDEFNLAVLDAFVNSFDM
AGKDIDTALRAFLASFRLPGEAQKIDRMMEAFARKYHADNPETFSSGDTVYVLCFALIML
NTDAHNPGVKNKMTLDQFFATTRGIDNGNDIDHNLLEALYSSIVNNEIKMDPDCEPSAFD
NPDKTGLLRKQGGRIKTWKKRWFLLSGSCLYYFRKEGDAVPKGIVPLENLQTNITGPTTW
ELTHPDGAFKAAKFSRSTVAESNHDKFVLEAASTAERDEWIAAIQTHIIRDPFYELLRSK
RLALTEEIAAFGGGKKGASTVMLRRRAASEMHNDEFAAMVDEARNDESGPGPEPEQKMGD
KAKAGGEDKNAANNAVGLRREDSGTGVEAAPDAKVQPKSKSKEKDKGKSRGKAKRKNKPK
NGVVDQVTSEPSADIGPTVEPTPEPTPEPESESKTKAKSKAKTKDKNKNKSKSKNKGKV
Download sequence
Identical sequences A0A0L0D475
XP_013759886.1.50528 AMSG_03538T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]