SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03574T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03574T0
Domain Number 1 Region: 219-271
Classification Level Classification E-value
Superfamily F-box domain 0.000000000013
Family F-box domain 0.0018
Further Details:      
 
Domain Number 2 Region: 294-362
Classification Level Classification E-value
Superfamily RNI-like 0.0000133
Family 28-residue LRR 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_03574T0
Sequence length 499
Comment | AMSG_03574 | Thecamonas trahens ATCC 50062 hypothetical protein (500 aa)
Sequence
MASSSSTSPDSLSPSPPNIPTTPFTVHLPPASGKSTKTKAMTVAPDHLLLVVVTDRATAK
KKKQGRQWVVDLRRDVPEVMTLDDVKSKFLTIGDGDDVLGGGLTVVPVGCEEVTLFLLLN
PILARLARIAIVVAHSIPYSTIMRLVRDRAVAHLPRILNTPRSLQSFESIESLYLFKNCD
HIGTAIRGALTEIKGRLAAANQASLALASPPPPCGTDDALSAWAELPDELILTILSKLTI
FDCLRAREVCKSWARVGTDASLYRRLRLVDIAAVCGEPADSVLLGKVLAVPLVSRHIRRL
DLSSSSVDVEGLDILRFRANKLKYLDTSGCDFTRRRLKSGWLKAMSSLEVLDASGFGNLC
YDFPDVAGVDLVGTNQIAPGHFISIDGALHIVFNIEVVSRQRHPLCILTSADVTTGHPSP
LLVMTQKAARELNVFAVSNSSYDVVDVKRYPLLRDPTTGTTRSDVWASDDLLAELHSGER
QVRVFEYAGKAYMMVWFGL
Download sequence
Identical sequences A0A0L0D508
AMSG_03574T0 XP_013759920.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]