SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03697T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03697T0
Domain Number 1 Region: 4-59
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000235
Family F-box domain 0.0023
Further Details:      
 
Domain Number 2 Region: 237-578
Classification Level Classification E-value
Superfamily RNI-like 0.00000000107
Family Rna1p (RanGAP1), N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_03697T0
Sequence length 607
Comment | AMSG_03697 | Thecamonas trahens ATCC 50062 hypothetical protein (608 aa)
Sequence
MPKEPRTFDSLPVELVLYAFSLLDRATLGRAAQVARKWHALANDGSLWRVLDLVPFAARV
DDSVLVRLVSAHPAIRILRVAGSVTDAGVAFALGRLTGLVELDMGAAARVFRAFNAYGPQ
LPLSLTEIVLPDVAYPRPGRMPRLVLADEAGGASSSAAGAAPSASSEPSSQASQLSPRPG
RLAEAMVEALGRGAVVAPEALFVLDILASAPRLRRLVVRREAFECGDWVVALAPRLCPKL
EVLELGDEFLGEAIEGLFSVSVAALRALAAARPPLRELVLTFCKVFGDSGDRRQLTGGGG
DDDGSYLDALSGLEALEVLRLRQTDVLSPVSRQLGLGSSFDALRVLEVPAGQLTEREVNI
LFGAMPVLEEFVVSAVWFLGTDPDPWIDWRKVPRLPPKLHTVALDYSFGFVEHLLTNLGA
RHQLRSLALKRFHMGRHPVGFSIRELLDYIVRDAPGLERLHLSVWREPADLSTYDANLLA
GPGVGLKLGLVLDGLPVLRELKLDGFALSHSNCAPHALVSVELRHCTYVQSLLEVAWLVG
VAPQLRRLVLTHVEAFSELELGMVLGIGRRLTSLELSCMGPQGSRGLAAWRALAARVMRS
NWNANWS
Download sequence
Identical sequences A0A0L0D4H4
AMSG_03697T0 XP_013759610.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]