SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03769T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03769T0
Domain Number 1 Region: 259-635
Classification Level Classification E-value
Superfamily RNI-like 2.12e-41
Family 28-residue LRR 0.057
Further Details:      
 
Domain Number 2 Region: 72-133,161-311
Classification Level Classification E-value
Superfamily L domain-like 6.46e-22
Family Polygalacturonase inhibiting protein PGIP 0.037
Further Details:      
 
Weak hits

Sequence:  AMSG_03769T0
Domain Number - Region: 703-727,777-825
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0785
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_03769T0
Sequence length 1325
Comment | AMSG_03769 | Thecamonas trahens ATCC 50062 hypothetical protein (1326 aa)
Sequence
MLPVFVVTVLALLVALSGCAASANPLMAEKAALDALFVTTHGSSWLEASGWNGPDVCMYA
GVRCGNATTDDGAVHVVELRLSNNGLTGSLPSEAAAWALPELLVLDLSANRMEGTLPGVW
ASAMPKLVEINVGGEALPDEAIWASMSLIAKYFFHTKVYSSNLLTGPLPPEWGSLSSLRR
LVLTTGGPASGAGLEGNFPPSWSGMTSLKVVFASQSGLGGSPLSSVLARIVGIEEVIVRD
CAFTGLPEEYKDSTISIFDIRNNPLNMPLPRWLPQWSAIRSLSLSNTGLTGSFYPELGAM
DKIAGLDLSINPDLRGTMHPEWGGMAALETFVIYETGLSGTIPPELGQLKALWLFVITFT
DITGTLPPELGDMTSMYQLLIYNNPGLSGTLPPELGKLPGLSVLKLFANNLTGTIPPSWG
TDMAAMYQLELGKNHLEGTIPPGFPLLAKLKLEENRLAGGLDVLCDKPQLQTVDVSSNAI
SAFPTTCDVYVKELNMAFNAFTGDIPSAERVHGLVTLKASHNQFSGGLLPSSWAKLNDTL
ESVDFSHNALAGPVSAYLDVLKHGTTLATVDFSHNALSGILQDSLFYVVNDHFLQGMVRL
FLNDNDITGLIPTVFSLLPHISEVDLSNNNLTGSASRITDDGVSILDLRGNAGLGEPDRL
SLPDNTIAVYPLIQPNPAIPYKCPSLTDPVTRRLTLYLDEGYYSASLCECLPNYHGSSGV
CLPCAHLAPAVTCHGGRVLLDVDGAGTALVYPANLTINPGYFVASTAASGAPLIDPCYPI
GVDETACNPSAGYPFTCSEGYEDRLCSRCARGHYPQGRRCRRCPRILPTILAIAYSIAFC
VWYALNQTGVRSVVLAPLVKSMFIFMQTSSLLFARSSAFVWPASVTTFFSGVFGWTSASA
NILTCLGSSNNSWETAFVASTLAVPVLVIFCLVAYCLLAILTKVSLNGLFGKPEKHWRYG
GIRSGLAVLNLVYMPITVGMLMVLPCRESADGKSYLWAAPWIECTSSSATWIRLVVIGAL
FSVLYGLGVPLVFLVLMRNRKSQLKRLKALKIAEVDGHWFQWFYAAYHDSCHWFEFAIMA
RRLAIAIIAIVPATSLAVPMGFFITIVAAMLVQIYTEPFIFPTLNKLELITLVQLLFTFV
AGQVFSSRIHERDLASSSGVLEVLVIGTNAVVVGLYIFVIARELHNRRGRLTGSPDAKLI
SVNPGVGTVHKERADPTPRTISAPHTPITRPAVLSGIANREYTYSYEYSEGYIDDEEQEE
ADAACDLFLSSSSITPPPASLTTTPSITRDALVADLRSLIDASNVAPSERHAVLASVLAT
WHAPR
Download sequence
Identical sequences A0A0L0D513
AMSG_03769T0 XP_013759673.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]