SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03802T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03802T0
Domain Number 1 Region: 115-221
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-18
Family Second domain of FERM 0.00078
Further Details:      
 
Weak hits

Sequence:  AMSG_03802T0
Domain Number - Region: 247-311
Classification Level Classification E-value
Superfamily PH domain-like 0.0101
Family Dcp1 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_03802T0
Sequence length 450
Comment | AMSG_03802 | Thecamonas trahens ATCC 50062 hypothetical protein (451 aa)
Sequence
MSSTVEVEVVDGTTQSIEVSSATTFGEASQAVGTGLGLSEAASQLFGIFHIRAGYERLPE
SDERVLATVQGFGADEKMAKKKKKVYKYRAGSKLVYKKVIQGRRKELLCIEVTALTLLYH
QAKADVINSVIPTHGPDAIELAGIQMQIEFGNYDEAARAPGFLEDNGLLDQFVPARSLAN
KLHTAREWETVIFQNYAEHFGKSHDAALRSYLNAARRSKYYGGRVFLPAKCYHRGSLIST
ARVQAIIASNQFMIVDPKSQKALWSFPFASLSEWKVSADGLSFAFYVVPKNKQKLDPFVL
ETPQAAYLAQSLAAAAAEAAEELNARKLESIAAFRAAARPQADSPSSRAVSKWKARAGIT
SSASSSDAGKPVLTRKVVRTRKSAAAAPLVVDPATAQAASDALASASSPSAGPKVTKRIR
VRRRKKPRAALADRDRPVAASPAQLAMSSV
Download sequence
Identical sequences A0A0L0D7T2
XP_013759706.1.50528 AMSG_03802T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]