SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_03977T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03977T0
Domain Number 1 Region: 13-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.18e-44
Family G proteins 0.0000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_03977T0
Sequence length 231
Comment | AMSG_03977 | Thecamonas trahens ATCC 50062 hypothetical protein (232 aa)
Sequence
MAAYSSGMDPDIAYTVRVVVIGDPSVGKSSVVRRLATGMFSENHIATIGAEFHNVVLEVP
IPPENAPVAVRVQLWDTAGQERYRSVAPAYYRGAPAVIVMYNVCAKSSFTAVASWLSEAA
AHLGHDGAVFALMGNKIDLADASGVGLREVSRDDGEALAAAHGMLFAETSAKTGAGVADA
YVAVAAAVLADEDARDRCTAQRHGARASGISIPRRREKAWIRAPGGPACGW
Download sequence
Identical sequences A0A0L0D6C3
XP_013759228.1.50528 AMSG_03977T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]