SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04099T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04099T0
Domain Number 1 Region: 59-294
Classification Level Classification E-value
Superfamily RNI-like 5.3e-26
Family Cyclin A/CDK2-associated p19, Skp2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_04099T0
Sequence length 304
Comment | AMSG_04099 | Thecamonas trahens ATCC 50062 hypothetical protein (305 aa)
Sequence
MDALDALLEAYDIPTEATTDDELAAVAAANSEMDLTRFASVSSAKISYATEYGQSITKLV
VVDTALTDADLAPLIDLLPALKEVDLSQSAKLTDVTLIALAQTSPGITKLTLNACTGFTD
AGIMVAALTLNSLTDLSLTACTKLTDQALEALSQAPCIASLTSLSLAYSTSYTSDTLEAL
LSETAALESLNLALVACVRNESLKVVADRAPRLRDLNIASCLLIDDDGIAELCGGDDDDA
EGIGPTLTTLNCASLPLVTDFGLSLLADYFPALRDLNLQLCEGITQLGAENLYNSAPHIA
KLTF
Download sequence
Identical sequences A0A0L0D686
AMSG_04099T0 XP_013759347.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]