SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04235T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04235T0
Domain Number 1 Region: 87-207
Classification Level Classification E-value
Superfamily RNI-like 9.61e-19
Family Cyclin A/CDK2-associated p19, Skp2 0.031
Further Details:      
 
Domain Number 2 Region: 15-61
Classification Level Classification E-value
Superfamily F-box domain 0.00000000183
Family F-box domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_04235T0
Sequence length 219
Comment | AMSG_04235 | Thecamonas trahens ATCC 50062 hypothetical protein (220 aa)
Sequence
MGRAAPGASDGMTSPANMLDEKCWRYIFKFLDTESLSKVAQTCHKWYDYAQFPGLWQSVE
LMLAKALVVDESLQVLGPKLELAKDVSFLSCRRLTADGLISAAPFLKNVETLNIGGVWNT
TDAALAKVLVHTPKLKSLFLGGCHLLTDASLVSVAKHCPALEHLSLRFLWNVTPAGITAL
LHALPSLKSLDVTYIDAVDDAAVEAISVEFRSVELITSS
Download sequence
Identical sequences A0A0L0D7D6
XP_013759016.1.50528 AMSG_04235T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]