SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04243T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04243T0
Domain Number 1 Region: 466-892
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.56e-90
Family UDP-glucose pyrophosphorylase 0.000000025
Further Details:      
 
Domain Number 2 Region: 193-430
Classification Level Classification E-value
Superfamily RNI-like 2.35e-20
Family 28-residue LRR 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_04243T0
Sequence length 919
Comment | AMSG_04243 | Thecamonas trahens ATCC 50062 UDP-glucose pyrophosphorylase 2 (920 aa)
Sequence
MTELSTLRYTGATSPPVRLEHVVALETIGESGQSLEELRWMAWQESKQTVSVAASSSSFA
AAPPPPAPPAEWTAAVRASHAAAAEFTTDPRLLLQSVVAPALPPPAAAAARRAAGDVRSL
EELAAGAVGRLVHAHAPATLRGACTNPGDSSPACQMLKDLDALVAGQVLSEWWPWWVARG
ANCRALMQLAFVPTPATSRLAASLTSLDLSRCAWSMTDASVELLASAKLSALRKLSLASC
PHLSDPAVASLLGSLTSGLEELSLANVFFGVETLTQLAVAPHVASLKVLNLSHRLSEPLA
QRGQLMPATSQALCALLGSVTALRVLDLDGVPFDASAISALIDSPSVSRLISLTVARNVL
VPPQFWLALVPHLVSIRYLDVRRTLMTDEAILLLLQSRPELEVFKISRALHWAGTLHVIQ
HVPSLLALYFDATVVHLALHNQADVRMRAELDELLATAQDAEDQFMMQQEFKTYHKLFSR
YLNEAGSTIKWDKIQPPADDLVIPFEELAAEARLPPKELLSKLAVLKLNGGLGTTMGCVG
PKSAIEVRAGQTFLDLTVRQIQHLNTTHGVSVPLVLMNSFNTHEDTLRIVRKYEGIEGVN
ILTFNQSRMPRIFKESLTPVPQTADDPDRTHWYPPGHGDVYASLERSGILDALRSMGKEI
VFISNVDNLGATVSLPILDKMVSSDGDIEFIMEVTDKTKADVKGGTIITYEGRSKLLEIA
QVPSDKVEEFKSIKKFKIFNTNSLWCSLPAIKRLVNDNALNMDIIVNNKSLSDGSSVIQL
EQACGAAMEYFRGAIGVNVPRSRFLPVKKTSDLLLVQSNLYDLVSGSLILSPLRIGGPPV
IKLGAEFSKMAGYQSRILSTPDLLELDHLTISGDVILGSDITLRGTVIIVASHGEHIDVP
SGAVFENKIVTGSLRILDH
Download sequence
Identical sequences A0A0L0D6N2
AMSG_04243T0 XP_013759024.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]