SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04299T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04299T0
Domain Number 1 Region: 119-260
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.67e-24
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.02
Further Details:      
 
Domain Number 2 Region: 2-131
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.76e-19
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.068
Further Details:      
 
Domain Number 3 Region: 349-415
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000859
Family Canonical RBD 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_04299T0
Sequence length 541
Comment | AMSG_04299 | Thecamonas trahens ATCC 50062 PAP associated domain containing 5 isoform a (542 aa)
Sequence
MRAKIIGRITEVVVGLWPEARVLVCGSVATGLYLFDSDIDLVVLGTDMTLGPVRLEMLKE
ALVQDEITTDDEVQVRGASRIPLLQFVEAYSRLTVDICFDVLGAVENVSFVRQSLYAIPE
LKALYFVLKTFLKQSNLNQVFSGGLSSHALILMLISFEQLRPMAASDAATLSGMVLGARL
TQFLQYYSLDFDYTQAISVLQGGYLFPKSIRRWLDPSRPELISIEDPSASNDICRQSYKY
PMVRSYFAEVGQTLLKFVYEGASEPVPSLLSTMIFPGPYAVFHKQRLESVAGWAAGRKSY
AKYSAQLHVGGGRRGVRGGRGAVRASARPRAAEQPDPDLSLDSADIHTVMMRNIPNKHSA
ASLLEVINKSFKGTYDFFYLPIDFKNKCNLGYAFINFIESQTVAAFAKAFDGVKWSSFNS
FKVCAISPARIQGKAALIAHFQNSSLMYREKACRPLIFVSSGPRRGEPLPFPFNTGAAGP
PGPGEWNSSQSCGPEARDSSASASGPSGPSTSTHPSPASHSAADSAPGSGPPRDICADSE
P
Download sequence
Identical sequences A0A0L0D9X2
AMSG_04299T0 XP_013759083.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]