SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04343T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04343T0
Domain Number 1 Region: 282-392
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000249
Family Second domain of FERM 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_04343T0
Sequence length 534
Comment | AMSG_04343 | Thecamonas trahens ATCC 50062 hypothetical protein (535 aa)
Sequence
MVSGHRLHKLRECVEAFKLRSSTCAGCGAVDEAATLVEPKTGLFCHKTVDCLSALKAKLA
ASCSSHGSSSATGDGDDDAPVARPPTDGSVSSDGSDDSDSSDVDDDAGGFTSSDGAATEA
GAQAQTAAPSSVAEAKACAAARPTRSTSAHQGSGLVLPALLKVHLLNGSSKLFPVDQLRV
RHADAQLTAGHVFEAMAEKIGLERREYALFALFAATDEEATAVSFDVVLPPALRLDDLWA
HFDAAVHMLRGTQARDSALPFVPLLYLRARPGLAVDDQRKAASRAALTLLFEETLSAVLT
SQVILPKSELITLGALLIQLYYGDHDKKKHLPGFFRAPSLLAELLPRHVLASSSFVSKQA
AWEKKMFKAHSKLVGYPPLLAKLAYDEHVRSLAPWLGAVLLPVSVESADPSLGKALAGPL
ILAVRDDTLFFISTPDPSGLVVSASTAGIRLDRPSASLVLASGEVVTFAPRPINDIVFAF
LAQARDAAPRIGADLDLTASTPAHRARSATIAVASPAALCAAIASAIPASYAYL
Download sequence
Identical sequences A0A0L0DA05
AMSG_04343T0 XP_013758686.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]