SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04370T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04370T0
Domain Number 1 Region: 111-235,279-447
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000942
Family Rna1p (RanGAP1), N-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_04370T0
Sequence length 610
Comment | AMSG_04370 | Thecamonas trahens ATCC 50062 hypothetical protein (611 aa)
Sequence
MADGAPPSAVGATRCVSYGSKAAGGQQQHALLALSEAKHLVRWKVVAADAAPELVGSVWG
IALTRITENAATYIALSATLARPASEDVLAGLQASCQASLSDLRMFLQNKHELLRVRFRP
YSRPHLLLQQVSDALLADAAHALAHNSIVSSITLARGSVSRHGVETLMELLASAAGLASS
LTAITLTSLQLSPHLLSAFVSGLAHCPIALASFKILGSTLADDAALVALVPALEALADAM
PSLVQLEVHVGDPRSALLPLSITNRVQRNRAAQLEHPDAVAGLEALDLVTNPEVDPELAA
RVARTLATAPKLKSLWIHDVGGAPQAVEALIRAGLGAPKLEAFRLSRTRRQPLTQPFLYP
LVDAILSAPHPDALALRYLELSGLELSTIAEGDSSPLLASLLALIRANTPLQVLVAPQDG
VVAESVLTALAAAVSDSNSSLLVLELGSPSSHAPVPTRIASVADGMAFGQPGLALLASAL
LANRDRAIKDIVAHLAANDPNTTILHSEILVDEHSLLHGGLADALRTNTVVETIRHFHTN
DAAAVALGEALLDNPRSGVRLIQLDGALTHPTCAIFTQLVHARENLSVSLGPANPYNEQS
RSFAHSPASV
Download sequence
Identical sequences A0A0L0D7V1
XP_013758711.1.50528 AMSG_04370T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]