SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04429T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04429T0
Domain Number 1 Region: 8-94
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000277
Family PWWP domain 0.0069
Further Details:      
 
Domain Number 2 Region: 219-286
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.000017
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_04429T0
Sequence length 321
Comment | AMSG_04429 | Thecamonas trahens ATCC 50062 hypothetical protein (322 aa)
Sequence
MAAQLKAKYPVNTCIWVRLRGHPYWPCIVIDPDDAPPEVVEGAGKKKATSLLVYWFGVPA
AQSFSWVGKNQSFMLWDDGLAKFGKKKDLARALKAREAYVNGTVLSDDDDEVDDGAAPMD
EAGEEARAAVDSESEASAPSSDDDDDDDDDEGYTESKSKKKKKAAPKKRKRAASKSNRAR
KKVAAAKYRSSRVDDRPRQLKKLDADLWDTLVLHRDLVANTGSVAELCVVLDRIANTETS
FIAVVSSRLGRHIAALTSHDDSNVAGKAAQIRDKWVAQLESHADKADLVTRLRAFDAVLG
VAPTPAAAAASSPAPEPVASS
Download sequence
Identical sequences A0A0L0D7M2
AMSG_04429T0 XP_013758769.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]