SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04435T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04435T0
Domain Number 1 Region: 57-114
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000085
Family Transcriptional factor domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1-47
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000000408
Family Transcriptional factor domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_04435T0
Sequence length 115
Comment | AMSG_04435 | Thecamonas trahens ATCC 50062 DNA-directed RNA polymerase subunit (116 aa)
Sequence
MEFCVECNNLLHPKCSQDNDGQFVLNLECMTCDFVGPASSMKVFTRKVVRRAEDTASQIT
DEVISDPTLPRSFQTKCASCGGEEAVFFQSHIKTGDTMTLFFVCCNEECKNRWTM
Download sequence
Identical sequences A0A0L0D811
XP_013758775.1.50528 AMSG_04435T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]