SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04465T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04465T0
Domain Number 1 Region: 53-336
Classification Level Classification E-value
Superfamily RNI-like 2.35e-54
Family 28-residue LRR 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_04465T0
Sequence length 357
Comment | AMSG_04465 | Thecamonas trahens ATCC 50062 leucine-rich repeat-containing protein (358 aa)
Sequence
MLTPFQLASGAGVSLNKSWAEKLVLASTDVEKVLEVYTEHCRANNVVPASSFAANPAVAH
LDMRHLGIGPRGLQALAEAIKVDPVVTKLNLDDNWLGSDGVPALIDLLTGAPHVRSLSVS
DNSLASGAAALFASMASNETLTCLDVSGNQIGDDETLALADLLDDNHTVVTIKAARNSIG
QIGARAIAHALENNIMVEHLDLSWNAIRLSGASALVRAAAMHPTLLYLDLAWNGLDDAAL
VSLGRGIRASPSLTFLSIAHNRFGFKGASALADGIRVNVTLDELILDGNVLATTKGSAER
ALVSALEENMTLARLSLNGVRLTTETATALAEMLRAKEATGHVLSIEPVSLLPQLGE
Download sequence
Identical sequences A0A0L0D7A5
XP_013758803.1.50528 AMSG_04465T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]