SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04745T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04745T0
Domain Number 1 Region: 441-803
Classification Level Classification E-value
Superfamily SIS domain 1.56e-98
Family double-SIS domain 0.000000359
Further Details:      
 
Domain Number 2 Region: 2-46,75-237,365-408
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.32e-48
Family Class II glutamine amidotransferases 0.000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_04745T0
Sequence length 804
Comment | AMSG_04745 | Thecamonas trahens ATCC 50062 glucosamine-fructose-6-phosphate aminotransferase 2 (805 aa)
Sequence
MCGIFAYINHLVPRKRALLLQVLINGLRRLEYRGYDSAGVATDGFRLAAAAAEEVTASGA
DGNNSVALPFPDNAPETRLFKNKGRVADLQDMIAGATAEEDLELELACHVGIAHTRWATH
GEPSAINSHPHRSDAANQFVVVHNGIVTNYRELKMLLESKGAVFESETDTEVVAKLFKIE
FDAIVADNNGEKPAFKDLLIHVMSLLEGAYALIVKSPHYPNEVVATKVGSPMVLGLRSKD
EIGIDLCELELYMQTTQADTLNSALADEIVRPGSRFLSQATLHQGQPSVPTGSKFSEILK
RRVGPESLVGWSSSPDLTLDASGASDGAFSSMPDVSSLGRSPSGSALSHVPSLADAHTVL
ERSAAEEPTAMEYFIASDASALIEHTRQVIYLENFDVLHIANGAYTITACVESKKSGEVT
PQSTPPSRRITELQMELEEIQKGKYKYFMLKEIMEQPESVYNTMRGRVLDNGTVVLGGLE
SRVDEILRSRRIIIIACGTSYHSGVASRPILEELTGIPVSCENGSDFLDRRAPIFRDDTV
FFISQSGETADVLRTLAYCKARGALCVGITNTVGSAIARETHCGVHVNAGAEIGVASTKA
YTSQCLALLLVALVLSRDKISHQARRKAIIQDLLTLPEKVKRVLELDEKIQALSADIATR
KSLLILGRGYGYATALEGALKIKEVTYLHAEGILAGELKHGTLALIDEEMPIIAIATRDR
LFTDLRSSLQQVAARSGNPVVICHDNDDETCDEYEHTLPVPPVQDCIQGILNVIPMQLIA
YHVADMLGLDVDRPRSLAKSVTTS
Download sequence
Identical sequences A0A0L0D9E9
AMSG_04745T0 XP_013758413.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]