SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04795T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04795T0
Domain Number 1 Region: 31-208
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000267
Family 28-residue LRR 0.011
Further Details:      
 
Domain Number 2 Region: 286-450
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000408
Family 28-residue LRR 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_04795T0
Sequence length 959
Comment | AMSG_04795 | Thecamonas trahens ATCC 50062 hypothetical protein (960 aa)
Sequence
MALRFVSTHMASTDTAAAAGGLIVAAANAGMEELELSHNAMTDDTRAALISALGAGSILL
PSLSSLVIVSNVVDQSLLSAVARASPALASIELRHCTAAEGSLTEVMEALANDCPDVEKL
VVVDSPIGNAGVRRWLAGPRPRLVHLALGDVGLGPTSVATLLAAELPALATLVLDDNPLG
TAAVERLLDAGSRWAPALQRLSLARTRVLPKDVPSLIARAETRRPTTDVTLAPQQKPVSA
RDAAYFGDGLDEWRQALAFAMTRVHSPSLIDLLASWHAAATSERLDGFYLGYLDLDGHDL
QQVVHLAAANVGALPAPAPICGIYLEGVQLGDGRVSELAAALDALPYPLEGVTTLVLKGT
SINADDANLLASALPRALPSLEVLDVSNNPELTTSSIVSLFATLATQGISLVVFAAASTA
LDTSAVAQLVAHAPAMPKLVEIDVRGNGLDADDLDDQVCDAARDAGIGIVFTDDDAPVYR
QEPLASPFTAHPPSGITLGDLDVSVAAAPSPLPQSTASTIRIQSSSDTEAASAPQQVAMQ
ATRHNVHTPMAGVQITNKIQIQLDVLLDAVEQLEPPSTKVMELVTSLRASLGATRDMLRK
TQREGAALETAVATTHTKLAGVQQEMKRLMAYSATASAVGPDLLAGALPPELDELDTQRF
VLRDQLRSLTSSTTQLLSLQADLLSSLLDESSALVQVSAAHARPSQWALLDAAGLGSHAK
LTELLAELESLAASMNELAGAEDRAAAAAVTATLAHDKVRKLELELAAAREAAVAADASA
RSADAAKLALRESVAAAASALNVNTIGTGSRNRINALAARLRTAHTHFADVVHAAESLAE
SQALAADESTSAAAELARVHTALAKVRGHEAAASEAMEALDAANELARKHRIQLGEVARL
ESRLALLEGDRDTALHNANLSLYKETELAYNQTSGLLANARFEAASLANSIDSMRVSMR
Download sequence
Identical sequences A0A0L0D812
XP_013758470.1.50528 AMSG_04795T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]