SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_04879T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_04879T0
Domain Number 1 Region: 490-558,591-703
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-26
Family RecA protein-like (ATPase-domain) 0.062
Further Details:      
 
Domain Number 2 Region: 324-416
Classification Level Classification E-value
Superfamily DNA primase core 6.93e-16
Family Primase fragment of primase-helicase protein 0.025
Further Details:      
 
Weak hits

Sequence:  AMSG_04879T0
Domain Number - Region: 106-180
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00204
Family Transcriptional factor domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_04879T0
Sequence length 731
Comment | AMSG_04879 | Thecamonas trahens ATCC 50062 helicase twinkle (732 aa)
Sequence
MQLRARWWAWRAGEGVARRGGTGVVVREAGEGAGRGLAVMATVRGVGRVPGWGWQLARAK
SSSAVRRQPHVIESTGSGSSSGSSSSGGLGAMPTFVSSHYRLSDSDVTSYLSRKGLVFRE
TPGEINVKACPFCKGNVGRVDNQWKLYFKRSDGACFCHRCGFKGSWFDFKAKMGDVRPAE
QARPGPTSTLDASASLSGGGGASEAAKSKKAGVGAAAARAAARGLDLRALQQYPRSLGKS
PRALKYLTEERGLSVETLQKYSVGVATYGFPKDPSAGDGGGWQDHECVTFPWVAPSGRDG
ALAATRIKVRALSAKHLQRLDPKGGGWSLFGWQTVPDEARELVVTEGEYDAMAVWQATGR
PAVSLPNGARSLPVEVLPMLERFERIVLWMDDDMAGMEGAEKLARKLGVERTYLVRPSGC
PAVVEAVAASGGKLPKDANDALRAGLDMDALVVSAARMPHKQIVEFSDLRSEILTELSNP
EQACGVQSRTLPALNKVLKGHRKGELTILTGPTGAGKTSILSQLSLDYAAQGVPTLWGSF
ELSNVRLVKKMMQQLASLPLEHHLDQFDYWADAFEALPMHFMKFFGSSDIHAVLDAMEYA
VYVNDVEHIVLDNLQFMHSGQGKGFERFELLDKSIEALRKFATEHNVHISLVVHPRKVDD
DTLLNTSSVFGTAKATQEADNVIIIQRGKKYTYLDIRKNRFDGDLGIVPYTFDKSTCKIR
ELDADAMSHFS
Download sequence
Identical sequences A0A0L0D7R7
AMSG_04879T0 XP_013758547.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]