SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05088T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AMSG_05088T0
Domain Number - Region: 12-46
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.068
Family Transcriptional factor domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_05088T0
Sequence length 640
Comment | AMSG_05088 | Thecamonas trahens ATCC 50062 hypothetical protein (641 aa)
Sequence
MKAVSKAGRAAKLVCRACGATKFALQDGGLMVCSRCSTVSSDYVAQETENSGDVWLGSSQ
LRKNMRSRLREERRMLRQKSKPGKKKRGRQNLPYMSLGQFLALQSKALKAVLAAASRNLG
LPSESVAWCRETYFAVIEGQRKRGHLLIDKTRSASQASLPFAIGVLGKEVAAKLGLRWRV
HRRSPLFRMTKEDMAADSFALADEPVETIDLAVGILETLGNRSGSLVYVLVGLAFAHAGL
PVSVLDIVRWQARGLLGWNEYDRIVRGWAHRGPFANILRSTLMFRRFYRVTTELVFRLVP
RDWLDPPSYLYIVRYARALELPPAMAHLALRIHGQMTLIARPQAESVPGTNEAVALAIAI
ALVRRYAFSYDQQQPHNAELTAVLQGIFEFDFPSWFEALAHKEMTRLRPDLALPRDDEYT
YGMAADGKPVSYDTALGLAVHGIETLALRCELPEQGSHNASRGIRTSLGLSADVMKELAS
ADPLVGSQPAEMEAMSYSETMSELLPNFDVSLDELELEQPLGRGAGTCELSDAAYDQAID
TVLSNLIKNAAWAEADGQNDQPQEALWVMHAIADHVGLEAEAFINSVDNWTNAVVFGGWD
LPAIATGEGIFSYWTKRGNAPEHMAVTHRPWSEAPPEVPT
Download sequence
Identical sequences A0A0L0DCT2
XP_013758146.1.50528 AMSG_05088T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]