SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05134T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05134T0
Domain Number 1 Region: 109-219
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-19
Family Second domain of FERM 0.00054
Further Details:      
 
Domain Number 2 Region: 4-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000187
Family Ubiquitin-related 0.06
Further Details:      
 
Weak hits

Sequence:  AMSG_05134T0
Domain Number - Region: 220-320
Classification Level Classification E-value
Superfamily PH domain-like 0.00467
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_05134T0
Sequence length 442
Comment | AMSG_05134 | Thecamonas trahens ATCC 50062 hypothetical protein (443 aa)
Sequence
MDFLQVHFVDGSHKTLRVEPETTVAELVAATADKLDLRATHLFAFWAVSPVLELCLSPDE
TIATVRDSWLDTERKYLGKPRKIKDPDEPIVSFVFKRQRLIPKAAEKSVDDPTAIHLLYR
QGIYEVVNSITVTSVRETIKLAGMQMQADFGDHNEATHTPGFLTSRLPAFIPRHLLEDKK
LKKRNWELDVLEAHKAFAGQDRTQIKLDYLAIVRKFPSYGSSYFPVDIKKAKRAPVKLPK
HDVLLGVNEAGVHLHNKKQHKDSVFIGLRELASWDSTDTLLTINVKPASSAGARAKKDSG
PLYILTTRQAPLIDSLLTTATDRYNNAVASYLDGGSKPKTKHPDSDSDSNSKQQPLPADL
PAASTAATAATAATAATAATAAAVDPEPAHDLDAAAQNPVSPAPTPAAAASASQDERAAK
IAQLNALCDSMAGSILDELDGW
Download sequence
Identical sequences A0A0L0D9X0
AMSG_05134T0 XP_013758179.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]