SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05214T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AMSG_05214T0
Domain Number - Region: 274-297
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0408
Family PhnA zinc-binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_05214T0
Sequence length 343
Comment | AMSG_05214 | Thecamonas trahens ATCC 50062 hypothetical protein (344 aa)
Sequence
MSFGRGLVVGSMSLVIFVGLLQLLAMYGRSWYSVELAKNRLSHVLSYEVTIGLRSVQKQI
CSPVECWREGQSLDSMRATSREWAGFDDAGKATFAVMWLSFVTLVAWFILGLARLLMHPL
TVERTKYHVAFGVGATFGLTVLALALYASRAPGFAYPVADPYLTAGLAPPPPPPPSMAPG
PSPSASPPPPPGGSGPGGGDRPLNFKDFTQAYGDQFSVALACMVLQTLAGLFLVVPFFQN
DELEDLQRAFLVEQPNGDVLAAVSPLLRDHLHVQCPQCHTQMAGPASTVVACPTCAAPIR
VPADVELVDMFEAYPPGHPLALAPPSHPECLSSGRLALAASPH
Download sequence
Identical sequences A0A0L0DAW3
AMSG_05214T0 XP_013757945.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]