SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05326T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05326T0
Domain Number 1 Region: 223-514,550-623
Classification Level Classification E-value
Superfamily RNI-like 8.32e-26
Family 28-residue LRR 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_05326T0
Sequence length 987
Comment | AMSG_05326 | Thecamonas trahens ATCC 50062 hypothetical protein (988 aa)
Sequence
MFVLAQVEWPLREAVLHGAWVVQVAGSTTRSRLVVITDYHLLLVKAGRVVKSSRKLVARY
PLLQLSAAAADLSAGQLKLDFVKPGELVLAGVPGAITQALVARYRLLTWGWPADLTVAFD
DFAWAAPPLDPPPLPAPSPGGNILTAYRSVAALQGWSAFSPDLDRFLAQIVDGPWARSLL
LSEVPNVSSSKKVSLNPLALALKFNRYFDRLELTDVSRPRILGLLAFALASNTTLTQLVV
SNCGARTGIDKLTAGLLANPGPASLALLDLSFNPLKDKGVAALAPALDTLPFLTTLNLKA
TSMTGDGLAALLASRPPDSPLHAITALDISSNRLEATGSSALGAWLAGHRVVRLQSLGLG
STDLHLGLLLQAMGMRVATVMPPAAVLSTLTALDLSGLDMDGDTIVRAVTFLSALSALAD
LNLSSMRVEPAYLARLVAAFGSASASHDGKCKLALADLDLSAGNAPLFLGSFGSFTSLHT
LVLDDLTAPPPVLLLLLNALKPFATSLRTLSLDRVFKTKSRDVPQVVMNLAALMATGAYS
EVSLVGAGSRRLGAHGAILLDALATQSFATLRALDVSYNRMGSALVAPLVLLLADNTTLV
SLSFDGNGLSLDEFTLVTDALASASALVEAVIPVRDIKVMRAKVGVETKLAIALLVKRIK
ETLAHNAAAAAAAAATAAAVATSSDASLNELNSSLGTSLAGDGLELPDSQPLRLRTGSRS
RTLLLERRASRVRLSIASAASLDDIEAALDDIEAGIGGPAPGHHPRTRSRLASRTFDSST
SSTSSDYSGYSRSAPQPSPTDTPCSDAEPEPNAASADAPSLASAARNRPPPPPVPTTDPR
FLPASAPAPVPAPAPPPTTSRRATLVKPPTSSADATRVPAKTKARRSTLVKPPSSAAIAA
AGGCGAPPPKPPPPAAALLAALPAVEPDSDSDEPEAEAEFTPTDYPRASVVCSSIERLLS
EINVSVDDGGYESDQGDDPLLHLLNAL
Download sequence
Identical sequences A0A0L0DAF5
AMSG_05326T0 XP_013758035.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]