SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05407T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05407T0
Domain Number 1 Region: 116-238
Classification Level Classification E-value
Superfamily RNI-like 0.000000785
Family 28-residue LRR 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_05407T0
Sequence length 267
Comment | AMSG_05407 | Thecamonas trahens ATCC 50062 hypothetical protein (268 aa)
Sequence
MAEPLPLHGLALRACAQLETACYIATHQQEALRGLSPTLRAMLLTSWTNKRVYGSSARAD
SLPGRTLVRLLLAGGAAAEIDALLLGQPEIRAPSELVLILLTQCLAATPLDRLVLDFTGA
ALTGELLLELAQQFRVVRGMSIRGGRWLYPDDLAAVFAALEPNTLEWLNAEWVSRLDDKA
FCALVASHGASLRIVDVSHATRLTDAALDALIAHVPNLEYIGLRGLTRLTLDGLRRLTAA
FPNLDAPTGQGCGNHIRPAAAGHWRLQ
Download sequence
Identical sequences A0A0L0DAM0
XP_013757828.1.50528 AMSG_05407T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]