SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05485T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05485T0
Domain Number 1 Region: 204-284,313-515
Classification Level Classification E-value
Superfamily RNI-like 8.44e-25
Family 28-residue LRR 0.062
Further Details:      
 
Domain Number 2 Region: 157-208
Classification Level Classification E-value
Superfamily F-box domain 0.000000406
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_05485T0
Sequence length 620
Comment | AMSG_05485 | Thecamonas trahens ATCC 50062 hypothetical protein (621 aa)
Sequence
MGCGSSRADQGKNGRGGSGNLVRASRRGGKSDRGGLTPLREVRAEREASLAQLDLASLPG
LAAWRALATLGEGCVERGDGRATAMSVFAPVVRVAAMRGDDPSAKLRVVGLQANQQCKGR
SRSKCKKNEVELVFEPSELRYFSAAMMETVMDAVSSGELSLFDILDDALVIRILWYLPLA
DFCHAAQVSLRLNLLTYDAELSTLWMVRTLATSRIRDSSLTRLAARSVSCILSLDLSNCQ
LVTDCGLRAILEVNPLMEDISLANCTGITRAGLMAVAELGTSLQRAVMPVTKARSHAESY
SDIIEVMAANATELVELDIDGWVVSANALACLLKQCSSLERLTVSLRSIPGESIVDDVGF
MQVCQYAHNIKGLVLNYPVELNSSSLTALLAHMGSLTALNIAHASFPRLALAPGMAPVLR
VIHLNDVAIDDAGLASLIASTPSLYHFELRFCAHLTDTFLSSPLPPSLQTLVLTSCPISD
RGVGFVARQLERLPRLLCLDLSHTNISEQSLSTLLGIGKSVPYIGIADCAAIQANSIIEF
YMRRHKQLKKYEAAFLEVIARAEPPSRFHLPSGEPRPLFASPSMAGMSGGPSGCRAKPTI
SSRLVESHVRGMHASLSGTR
Download sequence
Identical sequences A0A0L0DBI4
XP_013757890.1.50528 AMSG_05485T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]