SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05664T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05664T0
Domain Number 1 Region: 77-183
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000108
Family Iojap/YbeB-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_05664T0
Sequence length 199
Comment | AMSG_05664 | Thecamonas trahens ATCC 50062 iojap domain-containing protein (200 aa)
Sequence
MAAAWRLDKGPSGRNPLEGLKELLEAEALTEDVADVEAGHEAGADEATRGKAVLAEQAAA
LDEAKTSGRLEEALESLRLPVDAVAAMLDEAGGKVQVFDVGDSLDVVEHLVVTVGKSKRH
VAALARSAHAQLKRRPYPQVGTALLQRPGSRGDWWVLDTGEVLIHFMTEAADAEYDIGGL
WDGRLSPEEYDAEMRESER
Download sequence
Identical sequences A0A0L0DC18
AMSG_05664T0 XP_013757726.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]