SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05709T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05709T0
Domain Number 1 Region: 1843-2107
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.53e-24
Family Quinoprotein alcohol dehydrogenase-like 0.03
Further Details:      
 
Domain Number 2 Region: 1418-1538,1696-1786
Classification Level Classification E-value
Superfamily RNI-like 1.49e-16
Family Cyclin A/CDK2-associated p19, Skp2 0.039
Further Details:      
 
Weak hits

Sequence:  AMSG_05709T0
Domain Number - Region: 493-562
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0229
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_05709T0
Sequence length 2115
Comment | AMSG_05709 | Thecamonas trahens ATCC 50062 hypothetical protein (2116 aa)
Sequence
MSEGFLSRLAHTHALPAEDAVHVLQQELHDVAHASEGGAGAAMHAAYVAAMVATARAVAT
GGMTEVVSGLSVLYTDVVDPYAARLAAMESEAADELRLAFAHAMLDVVSTSLRPLADAKP
GLAPDLLRRSKAMLERALMVTISLVDERPAMRGSASLLLHAIGGLVHALLEHAPEAARLS
IRYATGHRPAMGYATSALALDDTHAARAAVTRALATYARAALIGSTDALISIVASDLAPT
LRNTPAAQQDAANHWFHRARVLYGVGLHEHAKTVAHHVAQFLARPGLAVPGGYEMRGKAK
ALFHAAVGVGSGGSGHGACSGSGELIEDASDYPHLFLRLRYAVGWVRHLISGLLLLLPPL
EGVPMMLADDAGVVYPLPEEPPRGPTDACPIPSALYSAFVSHLHAHKLLPDSLGRVRQVV
NYPTMGTATSEASSSTASDRSGTSGNDDSVVLVSKALSPAELAAAVFAAPETRATLELAC
ADPLFPGFTTLLHLQHALMRALLAHMWGLTDLVSSTPTGGASRGNSNAKTEYAFVALGSF
SRMEACPFSDLDAILLVDPNAPPSFRDGLGARARFFELLVMSLGETQFHVVKDWHHRDVS
IIESGFDLDEAHLSPVRTIVTPDELITLHVNAATELLKYEYDNVDPFTHAAREPSLVFGS
ARVFASYQAQLKQLFTSAAADFSPDVEAAADGVSLGALYALTTLDKNTGPGSAFAPVHLT
TRSRDELSIKTHAIRFVTMTVGALALYLDGMGIEVPETVLRLQRLAQARLIPPRLAIELI
RLHEWLFRTRFALHLSARRENDVVSRAAHGPTVAVLEKAASRILSPLYEAVRAFVASREP
RNTISSLVYLRAAEFSARLDAVSDVIVSDVFGEAEDGSFDRLELLRSVDELAFMGVRRGA
AIRRLHADVGALLFPGSDGESPDRGAPNDDSEVPGVESFGRAHVVYARGVHFKLYPLLPG
HEISVSLLAQSLFSEYTLTPLVDVAVVRHGGREHLLLMGETISRFNMLMALQTSPSGQLV
TGNSGLLEVLRGTMGFEFGVPTLPAPFAQLGTSKRPLEPSTNPSMARDERICFRSADGEL
GVNVALDMEQYSAAVLLALCVNPEDGKPDNHVVMLSEELPRRATPMVTEVADGKRAVVTY
RAQVVSVDNEYGFVEATKASCPQVKSIYFCMSALSLPVPVHLRKVVTRWDARHALASWLQ
HLQAAECEFKHLGAAIGDDELGVRFVAGIVHVLFHKLARLRRALQIARVTHRELLFQMER
ELAEHYLSAFKDPKLATPIERMLKIASSNYQQRTVLTSLLATARLVGLSVPSATPDLSEF
VTLTSAETIRNSQDRFVASGGAGPSQTTYDFAALAAARQDVLTHGSSSSVATLVEAGTAG
ERVGPDELLIELELLQEGENALEALIEHGDLRPFQALHLPQFKEAALKRLHLDKLGAELQ
RSVLKAIDGTLFVELHLPRCGELSDSVLKSIVSKCPALVELNVAHCSRIVSVGSVGIYAP
LLQVLDVSHTSVTLKALDGIEASAPHLTWLNIEGVAAIADSPRRIFQASPGLVWSRLPLR
LQYGLVLLHECAPSAQASGAVASLGSIPLFEFSAAARKRRKKHDKKVVAALKERWRSMAA
SGSRSRSGSLLSSSSAGSSFMASFKASLSASSCSSMSSLEPSVEVSESQQVQFSVDLGHP
PMATAGLGLLDRETALASFVMLVELDLVNTGLRVLHASVLCELLCDERMQQLRKLNVSWN
ELGNIGTSLLAQVWSSAGSQRSFVGLQVLDMRFNAIDDHGYENLASIREHEPPSSPRYIL
FDEPYSPRPRLLSLHAYETSEADWELLARARKQKVSAMVVLRTDVVVVGTPSGAVYAWDV
HSGSEPTLVANLHSAVHGLLQHPMDRSLVVATASGAFQLDVWSGVELNRMELLSGVEARV
VASIGLCATAVGCSDGVVRFWDTGSNEVLSELDTKGGAVTALTLLGDGTLAIGFESGTVE
IVELAGGRCVLSLTKGHRAAVTSVTDMGDGHVVSTGADGRMLAWDLRLVARSTTHRVVFE
MRRSAPASAIRAAIRLPDGALFAVATQHSQQSLHLVDIDGGLVATFEGELTRSVSAIGML
PTGELVTAARAFTGL
Download sequence
Identical sequences A0A0L0DC48
AMSG_05709T0 XP_013757755.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]