SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_05828T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05828T0
Domain Number 1 Region: 193-434
Classification Level Classification E-value
Superfamily RNI-like 5.84e-39
Family 28-residue LRR 0.0095
Further Details:      
 
Domain Number 2 Region: 71-165
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-21
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_05828T0
Sequence length 451
Comment | AMSG_05828 | Thecamonas trahens ATCC 50062 NOD3 protein (452 aa)
Sequence
MADSAVQTEIAALQEQVARDHEALRKASLNGQKLMMLCLKMNQKLNLMMEMAKNAVESVP
MGPSNEAVVAEQPLMCGFMNIKAKNERNWKRRWFVLRKGALAYYNDQNATTPKGTIPLAV
CVVDGLKVRDNMQRPCMALVVEGRTLYCEAETKKDNVAWFLAINCMQQQLDYSRKLEAQG
IEPDTRILAFFDHPLRTELALDDVSLSVEAITSMESTIRFHSALVSLSMQSAALRDEHVE
SLARALSGNKFLQTVRLGSNDLGPAAAASLAVALEKNAVITELNLAGNHIGDDGVLALAN
ALGSRPPLAVLDLSDNEVTDEGFAHFVDTLVTESYPLPALEFSSNAITSAGVVGSLVPAL
GALPSLTRVALASNAVDDAGVAAILGALPSSSLRELVLSNNPYAHEQHVEALLASLLATS
SLVLIDMVPVVLDEQSIATLRLLRDNDALAL
Download sequence
Identical sequences A0A0L0DCM5
XP_013757229.1.50528 AMSG_05828T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]