SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_06060T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_06060T0
Domain Number 1 Region: 379-559
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.91e-43
Family DNA polymerase beta-like 0.0000181
Further Details:      
 
Domain Number 2 Region: 226-317
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 3.14e-18
Family DNA polymerase beta, N-terminal domain-like 0.00078
Further Details:      
 
Domain Number 3 Region: 320-376
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 2.62e-16
Family DNA polymerase beta-like, second domain 0.00048
Further Details:      
 
Weak hits

Sequence:  AMSG_06060T0
Domain Number - Region: 65-162
Classification Level Classification E-value
Superfamily BRCT domain 0.00249
Family BRCT domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_06060T0
Sequence length 560
Comment | AMSG_06060 | Thecamonas trahens ATCC 50062 poll protein (561 aa)
Sequence
MAKRRAKGAASGGSERGGKRGKRSTATTSSTASTAPSAPSAASAASAASAPSAPLVAGSD
GTWADVRVYVVPLRIGAVQGRVLRNRVAALGGAVHDFVSPTTNVIVANLDVSELIEWLRQ
TTWNESNTPQEEPRFHKLDYLVDSLKQQSPISPHDFRLHSDEEYVAQVKMAKYQQYRREH
QRRADVSGTRTVALSVAGSDKMVSLEVSDELAKKRRKKARVLASREFFACQGAKATDPKG
NNMLVSRQLNELADMYKAEGDQWREYTTRNAARRIAKLPFALKSGAEATKLPKIGKKLGA
KIQEILDTGSLRKLENFKADDKVVALELFQSIWGVGAATARKWVHQRGWRTLRDVRDHAD
SLTTNQAIGLKYYHDIKSRIPRSEVMAIEARVREVATAVVPGVALTVCGSYRRGRLTCGD
IDVLFTHPDDKVAVSAVSRVVPALHDAGLLTHDLTSDNRGDSYMGLCRLGPDSLHRRIDL
KSFKQSEYGCALLYFSGSEHFCRSVRTWARRQGYSLSERALVRRFSRDTKSDLPIPGLFT
EEAVFQALGLKYVPPEERDI
Download sequence
Identical sequences A0A0L0DBR4
AMSG_06060T0 XP_013757566.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]