SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_06385T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_06385T0
Domain Number 1 Region: 117-505
Classification Level Classification E-value
Superfamily RNI-like 6.91e-24
Family 28-residue LRR 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_06385T0
Sequence length 551
Comment | AMSG_06385 | Thecamonas trahens ATCC 50062 hypothetical protein (552 aa)
Sequence
MACLQDAAMAAIAATFREGGPASRSMATAMAVPGALTADVAARLVEWAAARRVLSLPLLE
AVIATALPLQSLVITPHLLDAPLTAASHAATTTWMYSGAPSPNPATAAAPRLADALLSLR
SVAHLSLANIDATHGGVGRVLAAILASPAAPGLVSLDISFSDLGPALFHAAAAAAATDTP
LTALRSLRLYYCSDLAEDQLAALLKLAPHLVALDLGYSADVSLASLLVSRLERAPDSAIA
RVVRQLECLSLCGLELTDAINCVCDEPVGDVATIVKLVQRAPALTSLSLGGIRYLDVAGA
SAIVAATHAPLSSLSLASSFVQLLPDSPLASSSLAHLTALELRAIAWIDDAWLVAWADEM
AAAGGCLTTLGLANTSVCSEGVAAIAAVSPRLEKLDLGWSEVDDAALDALAHGCPHLSML
RLRCCEEVTSPALTALVAAAQELVVLDLARMSAVTDEVLASIAPSCTRLDVSWANEVTDV
GVAALVQRCQGMRIISLQGCKQVTLAGMGPSLRTGWQDLVALDVSCVPAPADHLLPRDRL
RGQSADAHVVG
Download sequence
Identical sequences A0A0L0DD12
AMSG_06385T0 XP_013757063.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]