SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_06438T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_06438T0
Domain Number 1 Region: 178-293
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000314
Family Second domain of FERM 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_06438T0
Sequence length 526
Comment | AMSG_06438 | Thecamonas trahens ATCC 50062 hypothetical protein (527 aa)
Sequence
MDAHSASYSSYEGGDLLDNSRILAPQTEYTDSVEVHLLGGAFVTMPVAESTTFDELRCDV
AVRMGLSADAAAAFDIFPVVAGYERRPRSYLEGRLSAGEDHGPAARVPPVAASLNRSELS
GAVPAQPEAATRVLATMREFKVLEERYVTNKAHEHAVPHSFLVFKKWDFSPATETSLETD
PVALRLVYQQAVYGVIHEWPVSDDVKFFIDLAALQMVVAFGPCPPARHAAGFLTSDGGLL
AQYLPEPLVAGATLFRLRELEARILDGYHGLQLETTEAAMAAYLAHARKLRMYGATTFVP
AKARTSLKTSIHGRIAVAISDSRLGFIEAKTRRLVGCYHFSHVLQWGGEHSHTSWTCSIL
SSKVHSMLSSGSHKLDNRGAHLVRSNSGELQPIAAGESTVYKFVTPQGHYISSALHKAVR
QHMADKAAGRVRRAHHRSTAGDAEPSASPPQIKSPVLKPASSDRRPSRADASSSAAAAAP
VPAPTPANDEPELPLSPTSGLPGVEAEDAFSDWDYYDDYDLEPARV
Download sequence
Identical sequences A0A0L0DD72
AMSG_06438T0 XP_013757106.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]