SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_06683T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_06683T0
Domain Number 1 Region: 200-349
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.88e-43
Family Poly(A) polymerase, PAP, middle domain 0.0000212
Further Details:      
 
Domain Number 2 Region: 4-198
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.85e-40
Family Poly(A) polymerase, PAP, N-terminal domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 351-479
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 3.14e-21
Family Poly(A) polymerase, PAP, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_06683T0
Sequence length 537
Comment | AMSG_06683 | Thecamonas trahens ATCC 50062 Poly(A) polymerase gamma (538 aa)
Sequence
MSLQWGVTPPLTLDTATEGEKALSRALREELVARGQFEPEAHARLRQKVIGKLNKMVKDW
VKETLLAKKQPPSVAASAGGKIFAYGSYRLGVCTESSDIDTLCVLPRDATVDDFFKTFKA
RLEARPEVTELVAVREAVVPIIKIVFATIQIDLIVASLSMSAIPDTLQLDNDMVLQGMTD
SGARTLNGSRVTDKILKVIPDPAPFRLVLRAIRLWSKSRLLYGFLKGFFNGITLAILVAR
VCQLVPYGAPAKIISMFFKLFKEWNFRKNPIRLVPAQDSMLGLTQWDPTNYRDRGHLMPV
LTPAYPSLNANTNITRSTIEIIRAEFERGEEIVNAVYAGQASWGKLFEPPRFFKMYRTFF
MITAYAATPEAMGVWHGYVESRLLRDFVMKLENELQIEAVHPYTKEFENVIPGEDRQNCV
FFVGVQFAEDLLKRRNKRIDLGAPAFAFQKRLSEWPDRSSDMTIDILPLKRKDLPPFVKE
LMKARRKAEKSAAKAAAAATAAVAAPPAIAAQPPPAPKRPLDEAPAAAPAKKQKMLE
Download sequence
Identical sequences A0A0L0DEY3
XP_013756744.1.50528 AMSG_06683T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]