SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_06725T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_06725T0
Domain Number 1 Region: 382-594
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.13e-36
Family DNA polymerase beta-like 0.00034
Further Details:      
 
Domain Number 2 Region: 246-319
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0000000000000249
Family DNA polymerase beta, N-terminal domain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 326-380
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.000000000000327
Family DNA polymerase beta-like, second domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_06725T0
Sequence length 596
Comment | AMSG_06725 | Thecamonas trahens ATCC 50062 polymerase (597 aa)
Sequence
MIRPRHGVAPSPSLSPPSPPPPFPLPPAATASTRSPTAATAARRRPGQARSAVPASPSPS
PSPPPRLRPLSASLSGALSSAVSSAAPSLAFSGLSSAAGSAAGSAAGSPRIVATALVRPR
LRGRHTTVIIPSPSLSPSSHGSRSRSRSRSRSRSRSRSPRRPSGGGAGDGGRGRAVRRQV
TLDVLPPTWDTALAGDGSEIGEEVLAEMVSGASRDELVQAADVTTLAVGLAAFLKPPEER
QAGGENAGTLKLLRELAGVYLILGDRQRHRAYSLAAIALASAPEPVTTAAQARALPGIGP
SIAAKIEAFVKTDRCAVLDRIYLSRKWEVMSRLVGIWGVGPSTAAHWMARGIESVEALRE
SGTLLSDRQAMGVKFYDDFQARMPRDEIDVHIGVVAKVVDELPDARDLGLVTVPAGSWRR
GKSSAHDVDILVTTRELQPMAALVGILDKIVDALYELDYVEATLRKSYGIGTRKHPSRNS
LSLAVEHEDFDVFFGVVSLPSPLSHLQPPLARRLDLIVVPRTRFAVTSLYFTGSAMFNRL
LRIHALALGYKLGNDKIFPVDDLGLPAGPPVAVLTEADVFDLLGLPFVPPTWRNNS
Download sequence
Identical sequences A0A0L0DFA0
XP_013756776.1.50528 AMSG_06725T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]