SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_06848T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_06848T0
Domain Number 1 Region: 646-978
Classification Level Classification E-value
Superfamily RNI-like 3.3e-36
Family 28-residue LRR 0.0043
Further Details:      
 
Domain Number 2 Region: 59-164
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000404
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 982-1114
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000811
Family 28-residue LRR 0.011
Further Details:      
 
Domain Number 4 Region: 361-472
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000157
Family Second domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_06848T0
Sequence length 1134
Comment | AMSG_06848 | Thecamonas trahens ATCC 50062 Gp29 protein (1135 aa)
Sequence
MAASSAAREALDANLRAVILGSGGKKWRIYPMRSAAASGGGGVASVGAAAQVKANAENVM
EICRRGDVSALVILCKKVGVDALVAYRDAAGESALHAAVESPTPDIVKALLRISCDPNTT
QEGTLNTPLHKAAMLGKTDMYTELVDAGGDAERVNSMGLTAAGIIANTTLGKGSKGSASE
ASEAAGATAASPVKHKFQAAARAALAVSRGANASDASAGASSSSEPRSSSTKCARMRLPE
RSMPQIHVGGDDVDGGSGSDSDASDAGEPVIYSVELADAVTKKVRASVNITGWALLGVVA
EKIGLEPQAAPYFAWCFASPDALPVYTWLDMGLPVSANGRADDALLLRVKYPSANMRRLG
EETPVAMNLLRQQVMQDVLAQGAGIHSQSVVLMLAAYRMQLNYGNHNPKTHQPGFLDTLM
DKYVSADMMAVGASEVLALQAQLFSMHRGLEGLTASEVHVKLDALLFSLPTYGAQVFPCT
LAGTGDADDISVVLLVGATGMLFGTPLTNIHSAAYPSYKYLPFSQIKRWKAISTALITQT
TTEFAAGGKEQVLQFVTPSARAILTLLNDYYTLYYQLVDDVEVSLPHPDESTISATLLPA
ELFGRPRAMFAPDPERSRLDILCRVYKSALRLQVGRADAGSILAQAYEALYKHETLRRLK
LRNPRHAAALFEAIHRAQSYVSVGFGGELMENLALAELDLTGVPFASSEAGTKALKLLAD
IAPSIEKLIMRGCAMGESAAMRLCHVVQAGSMALRELDISLNDLGPAGMDQILGLMQKKR
IRFRKLNLASTGMTDACVPVLMEIVRGSSDMNDTEELDISYNKITDKGFGDLCLALARNR
FLRTFAFGGNSVTDKSLGVFVSEVVDSPSVVFTSLSFAHIKIGSKAMEPLIRVATDKSLA
ELDITDCKLGKKNALALLEAVTASRGRTLTSLKIGSNGLDKAAIELLSSELSTSLSTLRY
LDIAGAGVGKNQWEAFIAVIGTSHLVSLSLVDTGLTDKSLALLCAALSSNTHLRNLNLAR
NEKLGKGLGLTAMAALLAANASKLTNVILSACKLKDRNLEQLLPAIHTNITLMALQLDGN
QFHDTVLADFLRAIDLSSNYNLALVDIRDNPGSDSAAVSELLPLAAHAECVVGH
Download sequence
Identical sequences A0A0L0DDY7
XP_013756903.1.50528 AMSG_06848T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]