SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_06892T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_06892T0
Domain Number 1 Region: 203-382
Classification Level Classification E-value
Superfamily RNI-like 1.29e-22
Family Cyclin A/CDK2-associated p19, Skp2 0.09
Further Details:      
 
Domain Number 2 Region: 40-159
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000746
Family 28-residue LRR 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_06892T0
Sequence length 433
Comment | AMSG_06892 | Thecamonas trahens ATCC 50062 hypothetical protein (434 aa)
Sequence
MSTAAHRVEVACAEQVGQVPACGTMVVGDDVKASLTSTELMAWITACDALGGLVLDETEA
IDADELLPHIATAAPDLHSLSLSWCSSWVTSDALTAGIAALTRLVELNVSVVRAIDDALL
AKLPVIAPGLKVLNVGGCPSVTMVGIASVVVGCPALEELVWGDEDDPDDAPKLVAVAKLL
ACAQSEWAAVDLSQTELLTDAALGVILAHNGLAAGVKDLVLRGCVSPQLTGAPLLGHLSM
PQLDVFDAGDVGLQSAALVAVISAAPALTELHLDACLGATDDVLAAVIAGCSHLTSLSLA
HCASLTPPALAMLGALTSLTELDISHTAADDAVLAALAPLTELRALYASCCTSITSAGLA
SLHVSVLDVSGCPGIERVPPRPTLSVLDIGGTSIDSLDRLAGISADSLLVVVTPPANRTD
SLFDDPAPASALA
Download sequence
Identical sequences A0A0L0DE18
XP_013756943.1.50528 AMSG_06892T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]