SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_06988T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_06988T0
Domain Number 1 Region: 1656-1837,1876-2006
Classification Level Classification E-value
Superfamily RNI-like 2.2e-31
Family 28-residue LRR 0.014
Further Details:      
 
Domain Number 2 Region: 870-959
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.43e-18
Family DEP domain 0.0018
Further Details:      
 
Weak hits

Sequence:  AMSG_06988T0
Domain Number - Region: 1558-1650,1787-1831
Classification Level Classification E-value
Superfamily L domain-like 0.0034
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_06988T0
Sequence length 2086
Comment | AMSG_06988 | Thecamonas trahens ATCC 50062 hypothetical protein (2087 aa)
Sequence
MDSLFLELLQPREPLPPSLHGSVPSRLTLARLVVRVATSAWTAPCGTVPETSLRATLEHA
ASHLPQALVAVDLLAPAEGVVADLAALLVTPLRPDSPRTAWVHIALASLLASAAACAETC
LEAARPRAAQGFLSLVERYAGYADRTPEVVALEAGVQKRLGDIEIALFDTPQDTPGARDE
PLFPRLEQLRANSPFEALPPLPAYTRIAIRYAEAERQATEHAAQRRHQVALLRNAGMFEL
FHTDAFDVGLWPARLHRARQNVGELTLAAAADELLALAERTYLAQAFDLAVAFGALAFEA
GMGGDDACWGHAFRAHELLAAAVRAALDPSSFRLQYSESLPPLELPWAEAREGLAASRES
VADAPWLDPSIHATQLLDVHLQTSDHRVELFRALIADALASFAILHGVCEATPWFEEAVR
SRLTGASAEVSAVSSAKTAAVPESVGAPQHEVEAEAEVSARIEAELKAEYLTELEAWFEV
FVTALELKVIALGETSPNANSERWSRGFCFDDGGNTPLVKDPKLIQTPEGMVSLLWPPGS
YVPDLMLVGALPDAGFLFGDVDLYDEFHTRMRALLATPHPTLRGTLGQVYGAVLLKEALG
EGFKPKFLSSATPLLDVKQSMYRFCSLVVSGMVRLFARVITTSNARRPAYISHRVRVRSL
VADRALDAIIGRALLMGIALAAHLRNKAQALAGTEANVVYASEDAVPAGTRGYVVPPGAV
ETLARVYHAHVEPAWQAAVDFHDQLLELGIGQVASGALHEVAWESGGGDDTGLQVSAPVR
FQLALSDTSRFAEAQAEHVLDHVSERSELGTLLHALSHTLLSISTAEPPRAVGGGGRRAE
ASAAVHVSTWPLESSGGNGPPVVVEHGVAAWWTAVLAFSRSIDIRSRRYRLRVYRECFVG
NEAVRLLKATFPDVNTTGQALAVGNTMMREGVFSHVVDKKQVFRDGHFFYRFSKDLDLAA
IAAKARREERDSHSSHRTSTGLDAALLQQLSPLIAWIVDADHTPWQLLTSAGHEPAAAVE
SPNVLDSVVVSGLWGHVAALDAWYQALVTSKAFPSGTAALKEKLCTVCRALAAHFTVAAE
SMGEVVATLRTQPGESVEAQAAMAVARDAVQPHVVVHGVTSGVRVLRAGGDQTLVEAAVQ
GKLALKPIQASPGFTYAMQLFIPLTIAGGAALDERVLADLVKVQPRHNAMRMSPSRAQAS
DLFHVFAKYPGEESLRAVLEARPHGDDVLSTSWLPWQYTTAFLRTTLMQPSSASADAYKV
RYMKRADGSKVPIALPVAHSNLFAADAFGWAASLGQRRTLSIALCFDQMLAPMDEEAMKA
FMDRRPQTVISMWLAAMDRYNRRIEAMFTLSELDDLFAGGDGSLLPFFVPADLVQNLYDR
YVHMQALLASAVDAGAPLTHLELLLAIDPDIGAMYREVLESAPGPLARYAAAEKRMAAAA
AAVRVRANSTSPRGAPASAWGKSRLSSVSAFVADGRMEPQAVLGSLQFDSAESSQMALAG
ARDSLVYGNGSEFAALGELGAKENVVRLVPFANLSPGEQVRVLENVRDTPFRLAAILEHT
PHLELLDVSFSSGLVSPTGSLTEMPKLHTLVLRGVTTLAALEQRSRRSRYLPALARLDVR
GCGALKMLDIPKFPLSIRIDPSGLANMERVRVAGVEWTLAVCLVINTLNNTQADTLQLED
VSGVSAAEVQSLVGVVSKSQFVNALMLNRVSFAGGAGNLIPQLMRSANALKCVTISGCRG
VELAAVVAAATESAHLRQLTLSEFDFAAGGGALVRQFDAMLQARSSLRALTLRGCGLNGC
SRVLAALGRVLNRRGGGLSSLDLSDNGISGLGLAEVISGLLGGGEASAMGALGMMLGSAM
SRVGVGGRKVSGGGNSGAVHGTSLTTLVLDGNALGGRDLGALGGALAANCSLTALSLSRN
PIGEHMASFARGLSGNTRLTTLELDSAQLGDAGALALATALAGNRALRWLSLQANRISAD
AGAEVVAALVFVTHLNLAFNGWGEEEMFEALAVVAARVSSAGAESDDDDVSEASDPVSEG
ETGSSSSAQAPSSDRKRTVFVGESAVVELPWGVAQQKPAKSSSQKE
Download sequence
Identical sequences A0A0L0DFE6
XP_013756482.1.50528 AMSG_06988T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]