SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_07010T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_07010T0
Domain Number 1 Region: 10-126
Classification Level Classification E-value
Superfamily RNI-like 1.37e-22
Family 28-residue LRR 0.011
Further Details:      
 
Domain Number 2 Region: 291-384
Classification Level Classification E-value
Superfamily RNI-like 4.51e-20
Family 28-residue LRR 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_07010T0
Sequence length 424
Comment | AMSG_07010 | Thecamonas trahens ATCC 50062 hypothetical protein (425 aa)
Sequence
MREMVAVQIALSMGDHFYQLRTVSLRNASLGPDEIAIAATALGEKSTLRVLDVSGNRLGD
KGITTLCNALGNSSLQELACARNAISDAGMEALAHLLTSNPSLLWLDASHNLISDNGMIA
LYTAACSGTDLAGDSNAEAESDNDSERHLGADGSDSGAAAGSGDLELELSDTEPSPTLHK
GKKKGKGKTKAKTKAKTAAPDAGQSSSLSSSGTFDEEQEETATTSSSGSSSSDSGSDSDS
GSSLGSSTSSTSSDSDPDSASAPKGARAGDSTADVVALARKTKPKAPHGPLVHLLNLAHN
RIGDRGAQALAQLIAHKRARRTIARLDLCGNAIGSIGAVALALHVAPNEHLLTLDISRNP
MGADGAEAMLSLLESNHTLQELVLGALPVPVTEFCQRLERVATTARVTFPALTVVRGAYQ
PAQG
Download sequence
Identical sequences A0A0L0DFA7
AMSG_07010T0 XP_013756499.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]