SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_07061T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_07061T0
Domain Number 1 Region: 552-692
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.14e-26
Family Cofilin-like 0.0015
Further Details:      
 
Domain Number 2 Region: 1049-1108
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-19
Family SH3-domain 0.00074
Further Details:      
 
Domain Number 3 Region: 434-523
Classification Level Classification E-value
Superfamily RNI-like 0.000000000113
Family 28-residue LRR 0.01
Further Details:      
 
Domain Number 4 Region: 709-749
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000238
Family LIM domain 0.073
Further Details:      
 
Weak hits

Sequence:  AMSG_07061T0
Domain Number - Region: 750-776
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0076
Family LIM domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_07061T0
Sequence length 1109
Comment | AMSG_07061 | Thecamonas trahens ATCC 50062 hypothetical protein (1110 aa)
Sequence
MIQTFSSRVSELLPLLTEPAAAFRGEYSRLRAGVELMVGAAVVVQLWLLSFQLNMPWRYT
QLDKVAGWSLLENSQLPFMLMFWLAASLPLGYVGAFWLARSPLLRAAWHASRLGFFLGRS
LIFGILFMPILNYMFQILLCPKVMGSRPRPTELHCWHGEHLGAAVYALAAAIVLIFQAFA
EARTSDILMHESSNPLRTARHIVYLRTKVLVGVAALTGVKVFGHSQPVVQLVVFYVAAVT
AIVYVSIRTPFVVTVHVDSFGPGVTEQEMERRAQEAAHEVPSALNDVIVGLFTAWLFFLI
IASVNYRAGSASGVNATPYFMLLGIPGMAMIGFYLSWARRNVVKRSLPSKRKLPPPGTLE
AFWRHPNHSHLVPVSDMGGHAVAMRVLSDAGATALMARLADAERGTLATGFVTRLEILGP
NRYSLASAGWRRGGRMSRSGLGVLAPLMGEHSQLQAFKLEGQVVDDECVANFAQALSANA
SLVALELPNNGISESGLLSLVGIALGTRLARLNLSGNVVDPSARARVGDAVRAMLATEAE
RRGDDGLPLLEFDDSVAGAVAAVVDEDDSTRWVVLGYQSQPSSRGPNVLEVKATGEDGVE
ELAWELSDAGIQFALLQVVEPKTSLWKLVFITWVGESSPTSVRTFVNQHTADVAKVFRGY
HVQINARSEDDIAESVVLDLVAKGVGADYSAHGEGQGMRSSAPRPKPKPKPKGFAIKVAA
KPKCQVCKKDVFPADAVKDSGLTWHKACFRCSTCGLALNLKNFRSLKNVLYCGPHLPKAQ
HTQVADDIHTRRAVSAPKRTLAQGARVDLEGGKIVDRSQFDDAAFERESHLSSVNQSTEN
RPSESAYQGGIVPGSNTGPAVREWSKPKPAEPVADASASSGSTWGAPPPSSSSNSGGGWG
ARQNSTPAPAPEPEPEPEPAADDGWGQEAAAEPAADAGGWGQEAAAEPAADDGGWGEEAA
AEPAADDGGWGQEAAAEPAADAGGWGQEAAAEPAADDGGWGEEAAAADDGGWGEEAAAAD
DGGWGEEAAAADDGGWGEEAAAAEGEWDPSQYEQCRVLYEYDAADDTEISLVEGEIVYVY
EKVAEGWWIGGKDDGSEGMFPSNYCELIE
Download sequence
Identical sequences A0A0L0DFI2
AMSG_07061T0 XP_013756531.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]