SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_07335T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_07335T0
Domain Number 1 Region: 73-141
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000115
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_07335T0
Sequence length 144
Comment | AMSG_07335 | Thecamonas trahens ATCC 50062 hypothetical protein (145 aa)
Sequence
MRMTMLGVFQRVEARLTRELTEEEKASVRTVVDAAVFAALVKSEGLDDGDDAMRGRARLS
EHGVCEVVMSIRTELLKADTTADRQIELIRALAREHITFNVLKKTKVGKTLNKLRKSSDS
RVARMAKELILVLKRLVADRSSSS
Download sequence
Identical sequences A0A0L0DJ15
AMSG_07335T0 XP_013756245.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]