SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_07536T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_07536T0
Domain Number 1 Region: 1376-1666
Classification Level Classification E-value
Superfamily RNI-like 3.53e-22
Family 28-residue LRR 0.016
Further Details:      
 
Domain Number 2 Region: 399-589
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-22
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 
Domain Number 3 Region: 1104-1248
Classification Level Classification E-value
Superfamily RNI-like 0.0000000141
Family 28-residue LRR 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_07536T0
Sequence length 1927
Comment | AMSG_07536 | Thecamonas trahens ATCC 50062 hypothetical protein (1928 aa)
Sequence
MVSSGSPSPLHARTTTPTPSPTSSSTTAPYKSKSKTKPKSKIKSKSKSRKAKIKTKSIGS
KAKLKKAQSMAKVKGNAKDVVSLSPSPSPSPSPSSDARRHRKLKAKVKQQSPESPATVES
LVADSSPTPDSSMLLLDVDRRAPVGDSWSPRTESDVDADESACYDDDDDDDDELADANDD
DGDDDVRSRFKPASLVGDDPDDEYDETMSSFQAKAKTKAKTKPKPKAKTKTKTKTKTKAK
TKPELKTKTKAKAKTKAKTKTKTKTSPSAQYFELDDEYGDDDTLSSSFSFKARTRSKAKV
KAKAKAKTKAKAKTQSSDHLRITTRSPGRRRGRSRRSVEASASGYDMSATYEDENEALAR
AKTTEVTRSGSLTNVAGASSPPSSPPSTRSRSPAWQASVSYYSLTTETDSSGTTTSSASQ
SCSDSSSGHRHVHPLEMVGGVSGSSSTITLSSTSFASFSSTLTPVTGSDDGASASASASA
SASGPHAWRIIKQGLLSKRSGSRIKTWAKRFFRLRSDGVFEYARRTSADAPDDAYVPISL
EDVIVMPATNMRKRFCFQIHSPQRPNYYLRAGSNTDMLDWMQALNAHVAATRDAHDSFLY
VARTNDLDTAAVAATRIHLQERLKTWIPSSATLDPPRGHSPTCSLSRESSAQPTPRGSDA
EDNAEEPDFVTLTPSPAPRVAIPSSPSFSPAVSPAGPVPPARSLSPPPARPSRRVHWEQL
SSSASHGSGAGDAGSPRAQALGTGSGSLVEAPVSSDGVALTGASAQDAPSPEAVVRFKAD
IMHASGRRLESPPPSPPLASPRDDGGGRGSDSDSNSEVCSGSGSGSGSGSGLGSGNSDDD
AKISCETSRAGVASRSISGVAAARAARRARRKARRRAAAPVSLAVYAMEESDTQLAIAYV
AGEQMARMLKVEQKLLFCKWVSLLDANSQAAGGAVAVLFEFVLFVVQPSLPQLGADPVVL
HKIPLYALSHIQSHNPDDIRLLWLQAQHSVVFASHPARIREFLQALLTALRAVTLGWPAE
YTVDINVRRLLPPLDPLPLPARHCGGFVAAYRAFCVLYDVEICPAVVNHIQSLDDGIERE
FDVHMLALSANLRSGAPLHMPTTGPLLSALTHSAYFTHLSLHGISCKSVVPQLAQLLAHN
LHLTHFDLAELGLPSSSTAWRTLLTGLRDAMPRVRVLSLAGNPLPDKVLSELGTVLGAGT
SLVGLDLSAALPSSRTGVSTLLTALVAKRLELADLDWETLEDAAAASAAAGLGAEGSGGP
PTAAAAPDAGPSTGEPPTDDYSASPSSASAALPGGGATPSVFAGPGSRLAHSSSLSNLPF
EEGSVGDGEFVLDSSASDASLGSESESCDGCERCEASGYPRPAAPLAALDGRVVWTLRTL
NLASNKLSSSSAARALWNVVSLAPSLTRLDLSHTGIDCGVLAKTVQLAPSLQSLGLAGNT
LDKRALPALRAAVVTSPVHEVSLAGVRVGREGLVSLLACLLNDRSKPSVDVDVSNFDYGL
RGEQLLLAALADSKNLTALTMEGITLKTKNNDGVCELLLGLCKVDTLQELRFGRNLKHRG
KHTDLAMSLLVALTTSPGSTLHTLSLAGSADRKRYLGSSLEPLLLALKRAPALTELDISH
NRCSSTLSLLAATLKDAGPTGPMLRILRTDGNEVTLDGLVAFAKTIGDSASGLAALVDFP
PPRSDIAALIKHTPKEHRVEVRDTLASLLVEVDHALQDHAAAERVKQRQASAGGGSGGSS
SLELPSPATTPSASETTGLPMLEVHVVRDVSNASLSESLPTPTTPGAPTPRQRLRSMSCE
WGSAIESLGTLDSDDDYVYLAALVDDPDELRVTGPRSGAFTPTFIYDARFRSSAESLAIS
ADSMNFADEASSDTGHLAKFDAIAQSPVPAMGSPSSASIVSVSSDGGNNNVWGSSVETET
ESDDDDE
Download sequence
Identical sequences A0A0L0DJY9
XP_013756018.1.50528 AMSG_07536T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]