SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_07876T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_07876T0
Domain Number 1 Region: 24-452
Classification Level Classification E-value
Superfamily RNI-like 1.55e-86
Family 28-residue LRR 0.014
Further Details:      
 
Weak hits

Sequence:  AMSG_07876T0
Domain Number - Region: 432-491
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 0.0335
Family Aldo-keto reductases (NADP) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_07876T0
Sequence length 749
Comment | AMSG_07876 | Thecamonas trahens ATCC 50062 leucine Rich Repeat family protein (750 aa)
Sequence
MSTAGGGSLSAEDARDIYLAKADDLQLAPSAAREARFTAVLRKRCANGVFSLANSGLGMN
GAAAVAAALLYDSQFYRLDLSGNIVQDDGAKALAEMLRSNTGLVVVDLRSNDIGPAGGVA
IFDALLHNATVTTLDLSGVSGVNRNHIGIKGARMAGQTLRSNRVLHRISLRENGLGPEGV
AALADGLALNSSLAQLELGSNNIGKDGASALSATLRDGDSVLSLLHLERNDIGDTGAVAL
ADYISVSYNITDLDLSSNNIGEYGGRALGEAVENNGSLTALNLEHNRLGAAGATKIAQAA
QRNAKLRSLLLADNSIGPEAAHALGDLIRRNTTMTKLTLSHNQLADDGARALATALKTNT
SLVHLDVGYNSITDPGGKAFAAAIRNNTRLQFLSLKCNFLYDPAGEELARAVKFNSALLT
FDVNLNDFDYKSFAEIRRALEENRARYKAHTVDRFTSRIHALQSEEERLWDTLEELADEG
KARDAAASDVALLRTQYDRMQAAQEAHIADLELAVRNKVAEREAAELDVRTKTSAINQKK
LEKDTRYRNITSRLVREKDACVKLDKKINKCRRELDAIAADSEEQLEEWRAVLAQEQAEL
RLAVKEQQYQEQLLATLTDSGPAAAAVAAAADAAGPRPKKKRRTKAKRSAAGGKPKTRSK
TKRSSAGGKPKPKRSPGSKAGSKAGKAGTKGSKRRRRRKGAAAADTPPTANVDTDAAKAA
APSRATDADAADGQPEPAPPAVTVSSTID
Download sequence
Identical sequences A0A0L0DHU6
XP_013755668.1.50528 AMSG_07876T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]