SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_07953T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_07953T0
Domain Number 1 Region: 133-395
Classification Level Classification E-value
Superfamily RNI-like 2.35e-38
Family Cyclin A/CDK2-associated p19, Skp2 0.036
Further Details:      
 
Domain Number 2 Region: 91-151
Classification Level Classification E-value
Superfamily F-box domain 0.00000000327
Family F-box domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_07953T0
Sequence length 439
Comment | AMSG_07953 | Thecamonas trahens ATCC 50062 hypothetical protein (440 aa)
Sequence
MASGPPSLPSPSTSSSSTSAGWFTPSASASDTCDDLWSADASAAYAPPVASATSGSASPT
SASIDSTSDEFFSCCSPPLSPVSPSFPHHPAPPPLMGDLAPLPAELVLHILRFLPLRQRA
VMREVSRGCAELASIPLLWRTVRFSRHLALSRFDGAADLWLAAVTRAPYLTSALRSLSLA
TCKDVTDTGLALALPQLPRLESLDLSRCWGVTDALLASLALAPAAAHLRSLNLYMVYQVT
DVGITRLAPATPRLVRLNLYKCSLVTDTGLAVVAASCPDLVELTLYGLPHISDAGVAGAL
PLLPDLRKLNLGSCKQLTDAALINAASLPALATLHLLRCSAMSDALLRCLAASGTAASLV
SLNCHGLAKLTDSGVVVLAAVASDLERLNLSRCTGISADGAIAIVAKCRTLARLTLDARA
ISPELSVLAASRAVELVVA
Download sequence
Identical sequences A0A0L0DI01
AMSG_07953T0 XP_013755721.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]