SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AMSG_08236T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_08236T0
Domain Number 1 Region: 66-116
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.63e-16
Family Transcriptional factor domain 0.03
Further Details:      
 
Weak hits

Sequence:  AMSG_08236T0
Domain Number - Region: 7-38
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00315
Family Transcriptional factor domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_08236T0
Sequence length 119
Comment | AMSG_08236 | Thecamonas trahens ATCC 50062 hypothetical protein (120 aa)
Sequence
MDQFFATRFCPQCHNMYFPPRPSDTFMMCGLCGFKKPIREIAAEQVVTAVNVAPTGMRAE
ALRRKGIDKDAQKARIDEPCPECNAPQMLFHTAQLRSADEGQTIFYHCTECDHKFAVNS
Download sequence
Identical sequences A0A0L0DIP9
AMSG_08236T0 XP_013755572.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]